SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028779 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028779
Domain Number 1 Region: 282-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-51
Family SPRY domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily RING/U-box 1.54e-27
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 94-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000011
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028779
Domain Number - Region: 135-237
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0228
Family Cullin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028779   Gene: ENSMODG00000023185   Transcript: ENSMODT00000030360
Sequence length 469
Comment pep:novel chromosome:BROADO5:1:566241085:566242491:1 gene:ENSMODG00000023185 transcript:ENSMODT00000030360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPL
CRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQAVQKLFCEDDFSPLCVS
CLLPQEHEDHRVYPLEESAETCKAQLQEALGQAWDKAREAHMLLEQERERRLRCRREAAT
LKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEARISKYVQSLRKLIEELDKT
LEQPLVEMLLAGRSTLERSRELLLRCPEPAALSWTLCGTTGMRELLLAFQSHILLDPGTA
HSYLSISGDLKSVRLASHWWHLLDNQQEEVERLVCVLGAQSFTSGSHYWEVEVGSKTEWE
VGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDPEDTGPLHRLGIFLQYEGGH
LSFYNVTQGCLIYAFPPVTFQGPLRPFFSLGLLQEENQPIPLTICPLSP
Download sequence
Identical sequences F7C4U3
13616.ENSMODP00000028779 ENSMODP00000028779 ENSMODP00000028779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]