SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028780 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028780
Domain Number 1 Region: 277-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-51
Family SPRY domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily RING/U-box 1.11e-26
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 89-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000839
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028780
Domain Number - Region: 130-232
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.023
Family Cullin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028780   Gene: ENSMODG00000023186   Transcript: ENSMODT00000030361
Sequence length 466
Comment pep:novel chromosome:BROADO5:1:566232477:566233877:1 gene:ENSMODG00000023186 transcript:ENSMODT00000030361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPLCRASS
QPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQAVQKLFCEDDFSPLCVSCLLPQ
EHEGHRVYPLEESAETCKAQLQEALGQAWDKAREAHMLLEQERERRLRCRREAATLKRVI
LPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEARISKYVQSLRKLIEELDKTLEQPL
VEMLLAGRSTLERSRELLLRCPEPAALSWTLCGTTGMRELLLAFQSHILLDPGTAHSYLS
ISGDLKSVRLASHWWHLLDNQQEEVERLVCVLGAQSFTSGSHYWEVEVGSKTEWEVGICT
GPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDPEDTGPLHRLGIFLQYEGGHLSFYN
VTQGCLIYAFPPVTFQGPLRPFFSLGLLQEENQPIPLTICPLSPHP
Download sequence
Identical sequences F7C4T7
ENSMODP00000028780 ENSMODP00000028780 13616.ENSMODP00000028780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]