SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028980 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028980
Domain Number 1 Region: 283-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-52
Family SPRY domain 0.0000595
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily RING/U-box 1.16e-27
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 95-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000114
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028980
Domain Number - Region: 156-238
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0497
Family Cullin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028980   Gene: ENSMODG00000023226   Transcript: ENSMODT00000030558
Sequence length 468
Comment pep:novel chromosome:BROADO5:2:491998637:492000040:1 gene:ENSMODG00000023226 transcript:ENSMODT00000030558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISSLREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCP
LCRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQALQKLFCEDDFSPLCV
SCLLPQEHEGHRVYPLEESAETCKAQLQEALGQAWAKAREAHMLLEQERERRLRCRREAA
TLKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEARISKYVQSLRKLIEELDK
TLEQPLVEMLLAGRSTLERSWELLLRCPEPAALRWTLCGTTGMRELLLAFQSHIILDPGT
AHSNLSISADLKSVRLASRWWDLLDNQQEEVERLLCVLGAQSFTSGSHYWEVEVGSKTEW
EVGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDLEDTGPLHRLGIFLQYEAG
HLSFYNVTQGCLIYAFPPVTFQGPLRPFFSLGLMQEENEPSPLTICPL
Download sequence
Identical sequences F7AV24
13616.ENSMODP00000026987 13616.ENSMODP00000028980 ENSMODP00000026987 ENSMODP00000028980 ENSMODP00000026987 ENSMODP00000028980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]