SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029133 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029133
Domain Number 1 Region: 284-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-47
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily RING/U-box 1.32e-24
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 97-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029133   Gene: ENSMODG00000023250   Transcript: ENSMODT00000030707
Sequence length 469
Comment pep:novel chromosome:BROADO5:1:489163456:489164862:-1 gene:ENSMODG00000023250 transcript:ENSMODT00000030707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSPSNMDVSEMAEKLRTELTCAICLNLFTQAVTLDCGHSFCRECILQSWHKARVPWTCP
LCKASSQPRVLEPTRLLEDLTSISKQLRPPREGNMGGQVTCRQHLAVQKLFCEDDHSPLC
VSCLFSHEHEGHHVYPLEEVAETCKGQLQEALSQVWAKARETHMLLEQEIGRRLRCRLEA
SILKQVILPEYIKTHLVWTRDTQQALLDKEKRRNLKRLTASEVRISHYIQNLKKMNKELK
KTLGQPLVEMILDGRSTLERSQELLLQCPEPAALGWTVCGTTGMRELLLAFQSHISLDPG
TAHSDLIISGDLKSVMLASHWWGLLDNLQEGVECLLPVLGAQSFTSGSHYWEVEVGSKTE
WEVGISTGPENDQGIIHSDVLSLACLNMGDQFELWISYTMEDPEYTGPLHRLGIFLHYKE
GHLSFYNVTQGCLIYVFPPLTFQGPLRPFFSLGLLQEENQPTILTICPL
Download sequence
Identical sequences F6XQW8
ENSMODP00000029133 ENSMODP00000029133 13616.ENSMODP00000029133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]