SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029240 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029240
Domain Number 1 Region: 184-330
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.03e-41
Family Mannose 6-phosphate receptor domain 0.00000026
Further Details:      
 
Domain Number 2 Region: 334-481
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.71e-41
Family Mannose 6-phosphate receptor domain 0.000000907
Further Details:      
 
Domain Number 3 Region: 641-780
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-38
Family Mannose 6-phosphate receptor domain 0.0003
Further Details:      
 
Domain Number 4 Region: 1386-1527
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.29e-37
Family Mannose 6-phosphate receptor domain 0.00079
Further Details:      
 
Domain Number 5 Region: 1536-1667
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-35
Family Mannose 6-phosphate receptor domain 0.00000129
Further Details:      
 
Domain Number 6 Region: 778-942
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.02e-35
Family Mannose 6-phosphate receptor domain 0.0019
Further Details:      
 
Domain Number 7 Region: 1095-1237
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.33e-34
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1242-1382
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-33
Family Mannose 6-phosphate receptor domain 0.00014
Further Details:      
 
Domain Number 9 Region: 485-632
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-31
Family Mannose 6-phosphate receptor domain 0.00085
Further Details:      
 
Domain Number 10 Region: 2006-2145
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1672-1816
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-30
Family Mannose 6-phosphate receptor domain 0.00071
Further Details:      
 
Domain Number 12 Region: 59-181
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.76e-29
Family Mannose 6-phosphate receptor domain 0.00000315
Further Details:      
 
Domain Number 13 Region: 2151-2299
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.71e-27
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 14 Region: 1823-1916,1965-2008
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.71e-23
Family Mannose 6-phosphate receptor domain 0.0025
Further Details:      
 
Domain Number 15 Region: 951-1096
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.15e-21
Family Mannose 6-phosphate receptor domain 0.0037
Further Details:      
 
Domain Number 16 Region: 1914-1963
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000514
Family Fibronectin type II module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029240   Gene: ENSMODG00000007100   Transcript: ENSMODT00000030813
Sequence length 2520
Comment pep:novel chromosome:BROADO5:2:442405648:442549561:1 gene:ENSMODG00000007100 transcript:ENSMODT00000030813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAANAVASAAAAAAPPPSAHLRPWARRPARPLPPPPPPLLLLLLLVSAGEVAADQSFD
FQELCSYTWDAVDIENQTLYKINLCGNMAIPQCESSAICAFNRNTSVYHSVGDSSLKNGT
KSLLEFNTTISCVQQDMKTTVQSSITFLCGKTLGTPEFVTSTRCVHYFEWRTTVACKKDT
FKAIKEVPCYVFDEELRKHDLNPLINTSGSYLVDDSDHDTSLFINVCRDIGGSNQETRFC
PSGSAACLVKGNQAYDVGRPKEGLKLVRKDRLVLSYVKEGEDRPAFCEGHTPAVTITFIC
PSERREGTVPKLTAKSNCRYEIEWITEYACHRDYLESKTCILNSEQHDISIDLTPLTQKD
FDSPYFAADGKEYFYYMNVCGESQAPVCSEKELAAVCQVKKNPSGQVKIAGRYQNQTLRY
SDGDLALIYPDGDACSSGFQRMTVINFECNKSAGNDGKGTPVFTGEVDCTYFFTWDTKYA
CVKEKEDLLCRVTDGNRRYDLSSLVRHAELEKNWEAVDSSHVESGKKHIFINICHKVLQE
GKAKGCPEDAAICSVGDQGFKNLGKFVSSPIKNKDNIQLSYSDGDDCGQNKTITTIITLI
CKPGDLESAPVLRNSGDNGCLYEFEWHTAAACVLSKTEGDNCRVTDSQAGFSFDLSPLTK
KNGAYSVRTKKYNFYINVCGAVSQESCPPNSGACQRALCFSFSERKAWNLGVSSSALSYY
DGMIQLSYKGGTPYNDEKHTPRATLITFLCDREAGIGAPEYQEEDNSTYNFRWYTSYACP
EEPLECMVTDPNTLEQYDLSSLAKSEESSGRNWYAMDNSGEHSTWKKYYINICRPLNPIP
GCDQSASACQMKYEKDQDSFSETVAISNLGVAKTGPVIDGSGSLILEYLNGSPCVNSEGT
ATTYSTRIHLICSRGSLNTHPVFSIIRECTATFLWNTEAACPIKTTDENQACSIKDPNSG
FVFNFDPLTKPTGYVVSGAGKSFVFNICGTLPACGNIEGKEATGCEGEIKSEDLNNLKPE
RRVGAEKSLHLTTEGFITLTYKGALSTFTGASDAFIIRFICNDDVYPGKPKFLRQDVNSK
LGIYDTFFEFETALACIPSPVDCQVTDLAGNEYDLSGLSKTREPWIALDTSTEGKKRTFY
LNVCNPLPYIPGCHGSAVGSCVKSGDIGRNLGVVQISPQTAANGSLSIVYVNGDKCENQH
YSTRIIFECDQTPGSPVFQRKEDCEYVFLWRTIEACPIRKAEGDNCEVKDPRHGHIYNLK
ALAVNDTVVTAGEYSYYFRVCGSLSSNVCKSGDSSKKVSSCQEKKATPGFQKIAGSLLTQ
KLTYENGLIKINYTGGDTCHKVYQRSTTIFFYCDRTTQKPVFLKETLDCSYLFEWRTQYA
CPPFESIECSFRDQEGNSFDLSPLSRYTDNWEAITRTGAPERYFINICKSLAPQAGIGSC
PPDAAVCLVENSKYTTLGRVSDGPQWSNDGTAILTYVNGDLCPDKIRRKMTTVLLTCSES
HVDSRPMFISAVEECEYTFSWQTSAACPLKSNMQDNCQVTNPATGHLFDLNSLKNDSGYS
VAYSEKGLIYIGICGGTKNCPSGVGVCFGLTKINAGSWNSQLMYVDQVLQLVYDDGAPCP
SKNALKYKSVISFVCTHDSGANNKPVFVSLDKQTCTLYFSWHTPLACEKEEQCSVKNGSS
VIDLSPLIHRTGGYEAYNENDDLSDTKPDFYINICQALNPIHGVACPAGAAVCKVPVDDS
PIDIGRVTGPPQLNPATNEIYITFDSSTPCPLDRNANYSSIILFHCKRGIDMGSPKMIRT
SGCDYVFEWETPIVCPDDVKTVGCSVTDEQLYYSFNLSSLSKRPFKVTHGPHTYSVGVCT
GATSDPQASCKDGGVCLLSGSKASSFGRLASMSLDYRHQDETVILKYLNGDQCPPETEQG
DPCVFPFIYLGKSYDYCIREDKPKPWCAITENYDKHQKWGYCKFSNSHRSSTIIFSCDEN
IDIGTPQVFSETRGCEVTFEWKTKVVCPPKKMDCKFIQKHKTYDLRLLSSLTGSWLFVHD
GTSYYINLCQSIYKGPSGCPERASICKKSTSGTVQVLGLVHTQKLDVTGDKVLVTYSNGY
ECGQNKTATTVIELKCAKTVGKPMLKSFDRESCTYYIMWETRAACAVKPQEVEMVNGTII
NPVNDKRLSLGDIYFKLFSASGDMRPNGDAYMYEIQLSSITNSANPLCYGASICQVKTND
QHFGRQVGSSDKTRYYIQDDDLDVVFSSSSKCGKDNTKYVSSTIFFHCDPLEKDGIPEFS
HETADCQYLFSWYTSAVCPLGQLVNMIGTENLHQGGGNENQNHKGLSGRSQAVGAILSLL
LVVLTACLLIMLLYKKERRETVLHRISNCCKRSSNVSYKYTKVNTEEEADENETEWLMEE
IQLSASRPGKEGQENGHITTKSVKSDALTSLHADDQDSEDEVLTIPDVKIHLTRGTRPGG
TDKGRNLQRKTFKHGNDDIVGLLKGEKERKGKPKPGQQKAMDSAKPMSFHDDSDEDLLHV
Download sequence
Identical sequences F6SWY2
ENSMODP00000029240 ENSMODP00000029240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]