SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029412 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029412
Domain Number 1 Region: 70-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.37e-28
Family Laminin G-like module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029412   Gene: ENSMODG00000017570   Transcript: ENSMODT00000030986
Sequence length 1572
Comment pep:novel chromosome:BROADO5:4:424914702:424992530:-1 gene:ENSMODG00000017570 transcript:ENSMODT00000030986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAWAPGLWLVSLWVTCGGHGAESSKDSGGPCPTLQQEGLRLEASEESSANMTGFNLIK
RFALMKASTIKRIRNPKGPFILRLGNAQLALPTAQVFPGGLPDQFAIVLTVLLKKQTSKD
TWYLLQVTDKDGYPQISLDVNGHDKNLEFRARGLDGDFVSCIFPVAQLFDLRWHKLVLSV
TGRVVSVHMDCTSVSSQPVGPWHAVLPEGHVLLGMDAEQGKPVLFDLQQAHIYCDPALVM
EEGCCEVSPAGCPQEASKARRDTQNNELIEISPQAQGKVYTRCFCLEEPQDSKVNAQLSG
SSGEKREKGSKVGAEWCPPCASRAVESNVTLGPPGLKGGKGERGLPGPEGLKGEKGARGS
DCVRTSPEAPLQCAEGPKGEKGDRGDSGPTGIAGSTGQKGQKGERGDAGFKGSMGKPGRD
GRPGEICVIGPKGQKGDPGFVGPEGLTGEPGPPGLPGPPGIGLPGKPGDPGGPAGPKGDK
GSSGIPGKEGPGGKPGKPGTPGLKGEKGEPCEVCPTLPKELQNFVGLPGQPGPKGEPGEP
GPPKGEPGISGMKGEKGEPCLSCSPAQNILENKEGFGLPGFPGRAGEPGPTGIKGEKGNF
GEMGPVGQPGIPGAVGPAGIKGEKGEPCEQCPSLSETYSGALPGPPGERGEPGQPGMGQP
GKPGKAGEPGLKGQKGDAGNPGDPGKPGTEGQPGLSGQPGIRGRPGPKGEKGDACDACPT
LQGELPDGVGIPGKPGAKGDQGPEGVGRPGKPGQPGLPGVQGPPGLKGLQGDPGPPGMPV
QGPPGEAGAQGLPGTVGPPGPRGPPGFAGEKGAKGSAGAKGTEGPPGPPGLSVTGPPGRD
GPRGQPGLPGAGGTPGEKGARGEKGDPGECSCPPSSRGEPIFSGMPGPPGVPGPPGPPGM
PGRQGIPGHNGLPGLPGPAGDLRGQPPQESPQRNICGDCAQAQTGLPSSSLMKGEKGDQG
TPGVPGIDNCARCFLERDRPRAEEARGNGEGDPGCAGSPGQPGPPGLPGQRGEEGPPGMR
GSPGLPGPIGLQGERGLTGLTGDKGEPGPPGQPGYPGAMGPPGLPGIKGERGYTGPAGEK
GESGPPGAEGLPGPIGPAGPRGERGAQGGAGEKGDQVSAKGINGQPGFPGPPGPPGFPGK
AGPAGPPGPQAEKGSEGIRGPSGMPGPPGPPGPPGIQGPAGLEGLDGKDGKPGLRGDPGP
PGPPGLMGLPGFKGKTGHPGLPGPKGDCGKPGPPGSNGRPGSEGDPGPMGPQGRPGPPGH
AGPPGSPGQPGPSGISGIGLKGDRGAPGDRGLVGLPGEPGSPGHPGPPGEPGSDGATGKE
GPPGKPGPYGPVGPKGDPGSAGQKGQPGEKGRAGMPGGPGKSGSMGPVGPPGPSGERGHP
GSPGPAGSPGLPGLPGTMADVVNYDEIKRFIRQEIIKMFDERMAYYTSRMQFPVEMAAAP
GRPGPPGKDGPPGRPGSPGSPGLPGQIGREGRQGLPGMRGMPGTKGEKGDTGIGVAGESG
LPGPPGPQGPPGYGKLGPTGPMGQQGIPGIPGPPGPTGQPGKAGHCNPSDCFGAMPMEQQ
YPPVKSMKGPFG
Download sequence
Identical sequences F6RTJ1
ENSMODP00000029412 ENSMODP00000029412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]