SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029569 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029569
Domain Number 1 Region: 577-893
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-90
Family Protein kinases, catalytic subunit 0.0000000831
Further Details:      
 
Domain Number 2 Region: 190-264
Classification Level Classification E-value
Superfamily HR1 repeat 1.07e-20
Family HR1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 113-177
Classification Level Classification E-value
Superfamily HR1 repeat 2.62e-20
Family HR1 repeat 0.00023
Further Details:      
 
Domain Number 4 Region: 14-91
Classification Level Classification E-value
Superfamily HR1 repeat 4.45e-20
Family HR1 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 342-432
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000085
Family PLC-like (P variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029569   Gene: ENSMODG00000006395   Transcript: ENSMODT00000031143
Sequence length 909
Comment pep:novel chromosome:BROADO5:1:454509164:454526711:1 gene:ENSMODG00000006395 transcript:ENSMODT00000031143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGVTPKGSSTVQLGLGENPLDPSSQHRLEGEKEVIRKAIQKELKIKEGAENLRRVTTA
RRNLGHVDQLLRSSNRRLEQLHWDLQELNARILLPDETHSPAASEPHLREEKPVAKHLEA
LRKQLQIELKVKQGAENMTNTYANGSPKERRLLSAAQQMLRDSKVKIELLRMQIGKLGAS
GETLEPGPEQRRELRAGDLRHRFRIETAVAEGAKNVVKLLGGRRLQDRKALAEAQTRLRE
SLQKLDLLRLALERLMTELPPAHPLRILVARELREGMPRSPQPTGSLIKPIALTGTLEVR
LTGCQELLEVVPGRSRVAALMGSPGESRPWGWGKQQRVEELTKEVLAVLKVDNHMVGQTG
WGPVSAQAWDQTFLIPLERSRELEIGVQWRDWRELCGVAFLRLEDFLDNARHTLSLGLEP
QGQLFVEVMFCDPVIERRPRLQRQKRIFSKHRGQDFLRASQMNISMAAWGRLVMSLLPPC
SSSTLSPPGRPSSTSPHDSPGSLSPSSFPLTKPLVEETTPRKALVGEQLPPKPPRLHLPL
DSAFVESPCTKRPHMDYRNSLRQGPCATPIRKPPKFQDFCCIAVLGRGHFGKVLLAQYKK
TGTFYAIKALKKQEVLSRDELESLYCEKRILEMVGHSGHPFLLSLLVCFQTPSHFCFVTE
FVPGGDLMMRIHADVFPEPQARFYLACVVLGLQFLHEKKIVYRDLKLDNLLLDANGFLKI
ADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDESYTRAVDWWGLGVLLYEMLVGECPFP
GDTEEEVFDCIVNEEAPYPHFLSVEGLALIQKLLQKCPEKRLGAGRRDAEEIKVHPFFRS
TDWEALLSCRIQPPYVPMLRGPADLRHFDQEFTALPPALTPPDRHCPLTARQQAAFLGFD
FVSDQFLEA
Download sequence
Identical sequences F6TSX9
ENSMODP00000029569 ENSMODP00000029569 XP_007475158.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]