SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029651 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029651
Domain Number 1 Region: 2-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.4e-115
Family L-arabinose binding protein-like 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000029651
Domain Number - Region: 436-480
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00353
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029651   Gene: ENSMODG00000023364   Transcript: ENSMODT00000031224
Sequence length 769
Comment pep:known chromosome:BROADO5:3:527214486:527231086:1 gene:ENSMODG00000023364 transcript:ENSMODT00000031224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVVFAIDEINSDPHLLPNISLGFHLYNTYHSDEKTLESSLQWLTGQGPLIPNYSYGVKDK
SVAVIGGATSALSVQMGTLLNLYKFPQISYGPFDSILSDKVQFPFHYQMAPKDSSLYQGV
VRLIVYFEWNWVGLVVSDDMRGEEFLGEIRAEMAKSGICVSFTEKIPVSERTHMESHETF
MPRISMSATKVIVIHGDTDSLMIMRYSGIPLVVTWKIWIATSHWDITMRPHYLDGHTFHG
ALTFSHLMREIPGFKSFLKAVTPSNYPDDILLRGFWLSAFKCSDQPEDPEQEICSPNSSL
ETLPLYSFDTTMSAFSYTIYNAIYAVAWVIHEIFLRKSEKISLGVDEYLEPHSWQTILHY
SLKDIQFNNSAGDQVFVDETKISVAQYAIMNYAFFPKEIDELVKVGQFVPKAPFGQDFTI
CEDAIVWGWMDNKVPRGVCSDSCGPGFRKTLLEGQPTCCFDCSPCPEGEISSQIEHCMKC
PEIEYPNKQRDRCLSKVVTFLNMKEPLGMILTLMALSLSLLTVLVLVVFVMFQDTPIVKA
NNRTLSYTLLISLIFCFLCSLLFIGHPTTATCLLQQTLFAVVFTVAISSILAKTIIVVVA
FRGISPESRIRMFIHPRMSIYVVLICSGIQVIFCGIWLGTYPPFPEADAHSEYGHIIIRC
NEGSAFAFYCVLGYMGFLALATFTVAFLARNLPDTFNEAKFITFSMLVFCSVWATFLPTY
QSTKGKAMVTVEIFSILTSSAGLLGCIFIPKCYVILLKLEKNAQEQMKN
Download sequence
Identical sequences F6XKC6
ENSMODP00000029651 13616.ENSMODP00000029651 ENSMODP00000029651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]