SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029734 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029734
Domain Number 1 Region: 198-316
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 2 Region: 87-202
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 307-415
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 4-94
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-17
Family Cadherin 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000029734
Domain Number - Region: 404-473
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00366
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029734   Gene: ENSMODG00000013882   Transcript: ENSMODT00000031305
Sequence length 640
Comment pep:novel chromosome:BROADO5:1:449865285:449920632:-1 gene:ENSMODG00000013882 transcript:ENSMODT00000031305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSVMQVMASDADDPTYGSSARLVYSVLDGEQHFTVDNKTGVIRTAVADLDREKQERYEV
VIRATDMAGQLGGLSGSTTVTIVITDVNDNPPRFPQKMYQFSIVETAPIGTAIGRVKAED
SDVGENTDMTYQLKDEGGGDMFKVTTDSNTQEAIITVQKHLDFEAQATHTVVLEALNKFV
DPRFVDLGTFRDQAIVRVTVMDVDEPPEFRPPSGLMEVQEDAQIGSIVGVVTALDPDAAN
RPVRYAIDRDSDLEQIFNIDADTGAIVTGKGLDRETAGWHNITVLAMEADNHSQVSRASL
QIRILDVNDNPPELATPYEAAVCEDAKPGQLIQTISVVDRDEPQGGHRFYFRLVPEAVGN
PHFSLLDIKDNTAAVHTQHVGFNRQEQDVFFLPILVVDSGPPTLSSTGTLTIRVCGCDSA
GAIQSCNTTAYVMAASLSPGALIALLVCILILVVLVLLILTLKRHHKSHLSSEEDEDMRD
NVIKYNDEGGGEQDTEAYDMSALRSLYDFSEIKGGDGGGGGGGGVGSSSGGGLQAGLPSE
RPSLPLPQGAPSPELDFSLFRDFISRKVALADADLSVPPYDAFQTYAFEGADSPAASLSS
VHTRSSSEQDFSYLSSWGPRFRPLAALYAGHRADEEGDAS
Download sequence
Identical sequences F6TQJ0
13616.ENSMODP00000029734 ENSMODP00000029734 ENSMODP00000029734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]