SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029743 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029743
Domain Number 1 Region: 79-118
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000172
Family TNF receptor-like 0.003
Further Details:      
 
Domain Number 2 Region: 38-82
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000141
Family TNF receptor-like 0.0054
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000343
Family TNF receptor-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029743   Gene: ENSMODG00000013875   Transcript: ENSMODT00000031314
Sequence length 233
Comment pep:novel chromosome:BROADO5:1:449673822:449812980:1 gene:ENSMODG00000013875 transcript:ENSMODT00000031314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKLVTDCTEDSETQCMPCQEGEFQSSWNHDKYCHQHKYCDPNLHLQIQKEGSLEKDTICI
CTGGLHCSSPECESCSIHSPCQPGFGVYQTGTGTTDTICEPCKKGFYSNVSSAFEQCLPW
SSCEAPGLMKIQEGTDKTDVLCQLVYQNPDRISLLVLIPITVGIVFAVITLFYWKGLCFK
ELKKNKVEPQEPPGKHPQENDEDPFPVQETLLRGQPVTQEDGKESRISEQEGQ
Download sequence
Identical sequences F6TPY2
ENSMODP00000029743 ENSMODP00000029743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]