SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030256 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030256
Domain Number 1 Region: 424-511
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000707
Family DEATH domain, DD 0.0076
Further Details:      
 
Domain Number 2 Region: 76-122
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000124
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number 3 Region: 142-199
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000126
Family TNF receptor-like 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030256
Domain Number - Region: 610-666
Classification Level Classification E-value
Superfamily DEATH domain 0.00706
Family Caspase recruitment domain, CARD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030256   Gene: ENSMODG00000018876   Transcript: ENSMODT00000031827
Sequence length 671
Comment pep:novel chromosome:BROADO5:2:293397672:293501765:-1 gene:ENSMODG00000018876 transcript:ENSMODT00000031827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASASSTAAGRRCSSFPSSSSSRFARGPRAAMITHSFFLLIFLSTTPAQPKQLTSEQDA
MNHFGTYLHFDSATGHWLTCDKCPAGNFVSEHCTNTTLRVCSRCPPGTFTRHENGIQKCH
NCSQPCKQPMVEKIPCTALTDRECACPSGTFQSNGTCVPHTVCPVGWGVRKKGTETEDVR
CKQCPPGSFSDVPSSVKKCKTYTNCLSQNLMLVKLGTKETDNVCGPLPSFPGTLPSFPDT
AIFASPEQVEYHEVPPPTYIPKGMNSTGSNSSASARPKVHSGSQELAASKNATLSREMGG
VNKTSPNLQVVNHQQSHHHRHIQSVPKPLPPMEATGGERSSTPIKAPKRGSPRQNLHKHF
DINEHLPWMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSSIVEKAGLKKSVTPTQNR
EKWVYYCNGHGIDILKLVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQ
HWTIRGPEASLAQLISALRQHRRNDVVEKIRGLMEDTAQLEADKLALPSSPTPLSPSPIP
SPNPKSENATVLTVEPSPMDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDT
VLRQVRLDPCDLQPIFDDMLHILNPEELHVIEEIPQAEDKLDRLFEIIGVKSQEASQTLL
DSVYSHLPDLL
Download sequence
Identical sequences F6Z1T7
XP_007484101.1.35504 ENSMODP00000030256 ENSMODP00000030256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]