SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030485 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030485
Domain Number 1 Region: 285-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-59
Family SPRY domain 0.000019
Further Details:      
 
Domain Number 2 Region: 7-84
Classification Level Classification E-value
Superfamily RING/U-box 1.31e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 89-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-17
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030485   Gene: ENSMODG00000008884   Transcript: ENSMODT00000032056
Sequence length 467
Comment pep:novel chromosome:BROADO5:2:250737186:250756158:-1 gene:ENSMODG00000008884 transcript:ENSMODT00000032056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGFPVERLKEEAKCPICLDFLQDPVSVDCGHSFCLQCITEFCEKSDSSQGSVYSCPQC
RSQFHQNSFRPNRQLASMVESIKQLGLSSSPKKTWLCESHREELNYFCEEDQIPLCWMCD
TSPEHRTHKTIPLEEATRSYKVKVQLALEHVKQEMEEVLNHETNVGKKIVIWKEKVELWR
QQFMLEFQKQHGFLIQEEQQQLRRLEEEERVTLQKLKESKAKLAQQSKTLRNLTMELEEC
SQCTAWDLLENVKDVLRRSEKVTFQQPELISMDLKTTCCVPGMMMMLKRFQVNVRLDPAT
AHPSLHLTEDQQSIWDGHIWQEVPNNSERFDTWPCVLGMESFTSGKHYWIVTMEDKTEWG
LGVCLDTASRKGEATPSPENGVWALWLLEGNDYMVLATPSVPFFQRNRPKGIGVFLDCEA
GEVSFYNTTEENHIYTFTHVLSGIIRPYFFICDSAPLTLIPETERRN
Download sequence
Identical sequences F7G1H8
ENSMODP00000030485 ENSMODP00000030485 XP_007483132.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]