SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030761 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030761
Domain Number 1 Region: 2-433
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-112
Family L-arabinose binding protein-like 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030761
Domain Number - Region: 437-484
Classification Level Classification E-value
Superfamily TNF receptor-like 0.004
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030761   Gene: ENSMODG00000023618   Transcript: ENSMODT00000032331
Sequence length 769
Comment pep:known chromosome:BROADO5:4:398640862:398653708:1 gene:ENSMODG00000023618 transcript:ENSMODT00000032331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKHYYQVLALMFAVEEINRNPNLLPNMTLGFHIYNAYHNDDKILESYLMWLSGQAQTIPN
YNCERQAKSVVVIGGANSALTVSMGTLLELYKFPQISYGPFDPLLSDPVQFPSVYQMATS
DTSLSLGMVRLMVHFEWTWVGLVTSDDAIGEKFLRDMKEEMVRNYICVAIVQKISISQTM
DIDSQQEFLMKIIKSRANVIAIYGDIDSLLSVRFHEKPYFPRKIVWITTSDSDITNKPGA
VYFDNFHGALIFSTKTSQMPGFQHFLKTINPLNYPDDIFLEQFWVTTFGCTSNHRKGDGS
VCSQNASFDTLSLRYLDKIISFQSYTIYNTVYAVAWALHEMFLLSAPGQIALCVENPRIT
TVDKSRILLHSFLKNIRFNNSAGNQVVLEKKKKSMTNYDILNYVTFPNNTDILVKVGDWK
KYVYIKIREICWHTGQEAIPERCSKICGPGFHKKVQKGKPICCFDCVPCPVGQISNHTEQ
CMKCSEDQYPDRDRIYCLPKLVIFLDYEEPMGKTLASIAVCFSLLTVLVLWVFVKHKDTP
IVKANNRDLSYTLLISLSLCFLCSLLFIGPPTPTNCLLRQTTFGVMFTVAISSILAKTIT
VVLAFRATRPGSRSRRWVGSRGPISLVVFCTFIQVMLCAIWLLLSPPFPDADTHSDPEHI
ILECNEGSLIAFYSVLGYMAFLALGSFTVAFLARNLPDTFNEAKFITFSMLVFCSVWISF
LPTYQSTKGKMMVAVEVFSILSSSAGLLGCIFIPKCYVILVQPQKNTKK
Download sequence
Identical sequences F6ZM35
ENSMODP00000030761 ENSMODP00000030761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]