SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030763 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030763
Domain Number 1 Region: 2-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.15e-99
Family L-arabinose binding protein-like 0.00043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030763
Domain Number - Region: 431-479
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0195
Family TNF receptor-like 0.0078
Further Details:      
 
Domain Number - Region: 509-756
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0504
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030763   Gene: ENSMODG00000023619   Transcript: ENSMODT00000032333
Sequence length 777
Comment pep:novel chromosome:BROADO5:4:398673583:398739648:1 gene:ENSMODG00000023619 transcript:ENSMODT00000032333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYQVLALMFAVEEINRNPNLLPNRTLGFHIYNAYHNDDKILESSLMWLSGQAQTIPNYNC
ERQPKSVVVIGGANSALTVSMGSLLELYKFPQVTYGLFDPVLSDPAQFPSVYQMATSDTS
LSLGMVRLMVHFEWTWVGLVTSDDAIGEKFLRDMKEEMVRNYICVAITQKISIGQSMDID
THRLFLWKIIESRANVVVIYGDIDSLLSVRFPEKLYFFPKILWITTRDSDIFNKPGAVYF
DNFHGALMFSTQTSQMPGFQHFLKTINPLNYPDDIFLEQFWVTAFGCTSNHRKGDGGVCK
QNASFNTLSLSYLDEIMSYQSYTVYNAVYAVAWALHEMFLVRSEIEPKRHGDNQIIHPWK
VRPPLYALMIYCLRKQVIFLDYEEPMGKTLASIAISATLSSSPFPSASFAPCSSLALPLQ
QIVSSDKQHLESCSQCSRICRPGFHKKVQEGKPICCFDCVPCPEGQISNHTDSEQCMKCP
EDQYPNRERIYCLPKLVIFLDYEEPMGKTLASIAVCFSLLTVLVLWVFVKHKDTPIVKAN
NRDLSYTLLISLSLCFLCSLLFIGPPTPTNCLLRQTTFGVMFTVAISSILAKTITVVLAF
RATRPGSRSRRWVGSKAPISLVVFCTFIQVMLCAIWLFLSPPFPDADTHSDPEHIILECN
EGSLIAFYFVLGYIALLALGSFTVAFLARNLPDTFNEAKFITFSMLVFCSVWISFLPTYQ
STKGKMMVAVEVFSILSSSAGLLGCIFAPKCYVILVQPEKNTKKTLKNANSWIQEYS
Download sequence
Identical sequences F6ZM19
ENSMODP00000030763 ENSMODP00000030763 13616.ENSMODP00000030763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]