SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031003 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031003
Domain Number 1 Region: 356-438
Classification Level Classification E-value
Superfamily SEA domain 0.0000000458
Family SEA domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031003
Domain Number - Region: 311-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 282-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 554-612
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.0942
Family Photosystem I reaction center subunit XI, PsaL 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031003   Gene: ENSMODG00000004907   Transcript: ENSMODT00000032571
Sequence length 661
Comment pep:novel chromosome:BROADO5:2:256738695:256760085:-1 gene:ENSMODG00000004907 transcript:ENSMODT00000032571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETTSTEESTTQTSTSSSTLGTTETSTSYPGTSDTITTSPTSTETGTTAQATTETITPS
STTSDTIPTFSSTTESTSTEESTTKDSSTETATTAQATTETITPSSTTSDTIPTFSSTTE
STSTEESTTKDSSTETATTAQATTETITSSFTTFSTMTETTSTEESTTEASTSTPETSTV
ILETTGPSTTSPGISDIIPTSPNSTESGTTPQGTAEISTSSSGTSGTMSSPTTKVSTPTL
VSTMQPSTTWINATESGTTKSSTTVSITTIPTTNKPATTALFCLNGGTPDGNICNCPTGY
SGKWCEKENIICQNGGFWDEIKCICPDPYYGPKCEMISESITIEPPPEKVNATVEVTVSV
TNMEFTEDLKNESSEVYKNFIEDFKNKMAEIYKNIPNYVGVKITNIFEGSIVVEHEVILS
TNFTPNFKTELEAVTQKVQETIKKVTTEQVDNGSTNCSGFCFNPNRTTVSDPVFLYDPEV
ECKNKVRDEFKKFFFIDYQNGEPQCISKCMPNFKSSIDCHQGKCQLEPWTGPRCFCFNTD
THWYRGETCTLSTSKNLVYGLVGALGVVVLVTIVTLTAFMYRSQKKTQRQKAKLDQAYKW
HEEDGGPAPGSFQNIGFDIYDEQENSLQMDSIYSNFQPSLGHVDPEKKIHIQRPQVVMTS
V
Download sequence
Identical sequences F6XAU8
ENSMODP00000031003 ENSMODP00000031003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]