SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031142 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031142
Domain Number 1 Region: 321-403
Classification Level Classification E-value
Superfamily DEATH domain 1.61e-19
Family DEATH domain, DD 0.0011
Further Details:      
 
Domain Number 2 Region: 21-71
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000264
Family TNF receptor-like 0.0052
Further Details:      
 
Domain Number 3 Region: 79-126
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000404
Family TNF receptor-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031142   Gene: ENSMODG00000006096   Transcript: ENSMODT00000032711
Sequence length 406
Comment pep:novel chromosome:BROADO5:4:394683533:394686708:-1 gene:ENSMODG00000006096 transcript:ENSMODT00000032711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESDQVSLAQKCPTPQYFVDKSSSLCCRSCPAGHFLKAPCTESQGSSFCQPCHEDTFLSR
EDHNEKRCSRCQACDENGPANQVVVRNCSTVANTQCGCAPGWFRECSVSLCRADSPFVCI
RCLDCEALHRQTQSPCSRKDTDCGRCLPGFCQDQNGCAPCATSGTKVIEILILDPPSLSG
SWLQYFLLASMVLMILLLLGWGLFYSYQKCFVPMPRAHWNGSSLCFQVISPSPVGRASLP
LNSYSEKICALQLVGNCSPSSPTLVREVQSPEDAWPMLWSQPPSRGSGEQDGLNARAPSS
LRRRDGEQGSDGPGAGTLQPGPQLYEVMDAVPARRWKEFVRTLGLREAEIEAVEAEIGRF
RDQQYEMLKRWRQQQPAGLDAVYAALERMGLEGCAEDLRSRLQRGP
Download sequence
Identical sequences F6TY39
ENSMODP00000031142 ENSMODP00000031142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]