SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031163 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031163
Domain Number 1 Region: 320-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-69
Family SPRY domain 0.00000477
Further Details:      
 
Domain Number 2 Region: 40-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000267
Family V set domains (antibody variable domain-like) 0.00082
Further Details:      
 
Domain Number 3 Region: 160-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000286
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031163
Domain Number - Region: 287-330
Classification Level Classification E-value
Superfamily BAG domain 0.0282
Family BAG domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031163   Gene: ENSMODG00000003790   Transcript: ENSMODT00000032732
Sequence length 541
Comment pep:novel chromosome:BROADO5:2:258341743:258375340:1 gene:ENSMODG00000003790 transcript:ENSMODT00000032732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIPDFPHWSQSSSLSSCLLLLLYFMELNAEELMVFGYREPILAMVGEEVEFPCYLISK
LDAEDMQIRFFRNKISEIVHDYQDRQELFNRQMVQYQGRTQLLKDYIQEGSVALRLLHII
PADEGQYGCLFQSKDFSNNATWELEVAGLGSDPNIYFEGFEEGGIRLTCSSKGWYPKPKA
IWKDYQGQQLPFLSKTITQDAQGLFHLEMSVVVKEGAHSHVACSIQNTLLVQKKEFTLHI
ADVFLPKNSVWRGSFIGTLMGLVSLLVLCMILALYFFQKQRRSKEKLRKKSEKEKGKFTA
ELGKLQTEIDWRRAEGQAEWRAAKRYAVNVTLDPDTAHPGLNVSEDGKSVFYWNIKQDLP
DNPKRFENQLCVLGQEGFISGKHYWEVEVGEKSRWLLGVCSDSVDRKVEGKLCPGMGYWV
IGLWNGCEYFIFNPHRVSLTLRVPPRRVGVFLDYEAGKVSFFNVTDNSHIFTFTDKFSGT
LRPYFRPRSQDGGEQVIPLTICPLPKKGDRVAAEDDDCDTWLQPYDLSESAEIRILNTFV
E
Download sequence
Identical sequences F6TGW8
ENSMODP00000031163 XP_007483404.1.35504 ENSMODP00000031163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]