SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031349 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031349
Domain Number 1 Region: 480-651
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-49
Family SPRY domain 0.0000386
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Immunoglobulin 4.69e-20
Family V set domains (antibody variable domain-like) 0.00017
Further Details:      
 
Domain Number 3 Region: 128-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000191
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031349   Gene: ENSMODG00000014776   Transcript: ENSMODT00000032921
Sequence length 672
Comment pep:novel chromosome:BROADO5:2:275495260:275502649:1 gene:ENSMODG00000014776 transcript:ENSMODT00000032921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVVLGPTEPIVALLGTDIILPCRLFPLMSAEHMEVRWFRSQFSEAVFVFQKGKEETDEQ
LVEYTGRTELISEFISKGSLSVKIYNVQMSDNGKYQCYFRKGDVYEQASLEVKVAGLGSA
PHLRLEGHEDGGVKLACMADGWFPQPQVQWRDNRGGKLSSLSETQAQDEAGFFHVKALIV
VQESSVRNVSCSICNKLLSQEKISAIDIPGQFSVLKRMIRVGVNGTGGRTISFFPKTSPW
KKALISIFFILKERKKVKKLLQENKEEQKAKELGKFNFPPQLNSACVSPRTNFRMIHLLF
IDKGSSSHAVSSFCFLSAWRKAHIYAGESLLFPRITTSPISGDFLSWLHKRGRKGARMKA
EGGCKDSVESAMVSLWDCPTDPRTLHLFYPLWKRHSGMRKQPSCTVSFAKAFHNTRFSIG
SQLLSSSDEGGPCAERNLWQGLIRERLEPVRQATAQLLLKALKGLSVHAFSWTCIDLVPL
SAVNVTLDPASAHPGLVLSRNGKDTKVESARTSAEETFSVLGREPITSGRHYWEVKVEME
AQNKATWHLGICREGASRSGWVRESLEEGFWAVGCSDGIFWPIVSKQSVAPFLGKPPEQI
GIFLDYEAGDVSFYNMTDGSHIYNFPPASFSGPVRPYFSIQTLDTSFTICGVSDRPESIP
APSLETPGTAQE
Download sequence
Identical sequences F6UV92
13616.ENSMODP00000031349 ENSMODP00000031349 ENSMODP00000031349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]