SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031363 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031363
Domain Number 1 Region: 2110-2221
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 2 Region: 1060-1165
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 1800-1908
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 1585-1693
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.00095
Further Details:      
 
Domain Number 5 Region: 852-959
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1902-2005
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 337-446
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 8 Region: 2209-2327
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 546-666
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 10 Region: 235-356
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 11 Region: 2562-2740
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-22
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 12 Region: 1695-1806
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-21
Family Cadherin 0.0032
Further Details:      
 
Domain Number 13 Region: 959-1066
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 14 Region: 25-133
Classification Level Classification E-value
Superfamily Cadherin-like 3.62e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 15 Region: 2008-2116
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 16 Region: 443-566
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 1269-1379
Classification Level Classification E-value
Superfamily Cadherin-like 2e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 1166-1263
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-18
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 1373-1476
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 20 Region: 1483-1592
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 21 Region: 654-775
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000011
Family Cadherin 0.007
Further Details:      
 
Domain Number 22 Region: 762-864
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000614
Family Cadherin 0.0025
Further Details:      
 
Domain Number 23 Region: 143-231
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.01
Further Details:      
 
Domain Number 24 Region: 2744-2781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 25 Region: 2323-2414
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000214
Family Cadherin 0.0091
Further Details:      
 
Domain Number 26 Region: 2782-2819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031363   Gene: ENSMODG00000009050   Transcript: ENSMODT00000032936
Sequence length 3149
Comment pep:novel chromosome:BROADO5:1:345548436:345630563:-1 gene:ENSMODG00000009050 transcript:ENSMODT00000032936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPICFQVAVQDNGKPSLQSTSRVVVRVLDVNDNSPTFSHKRFKIRLPERQDSSVPRPVYR
LVASDRDEGPNGKVSYSIEENYEEAFTIDAETGLVSASVNFPAGEYNILTIQAVDSGQPP
RSSSVRLHIEWIPRPNPSGKLWVFDEPHYNFDAVETDPVNHMVGMVSVEDPPGLLWFNIS
GGDENMDFDIEMTTGSMVIARQLDSRRKANYNLTVEATDGSRTITTQVFIQLIIINQHRP
QFLEAQYEVKVPQGTPPGLELLRVQATDQDKGKNLVYTIQGSLDARSTKLFQLDPNSGSL
VTVGKLDMDSGLSRHILTVMVRDQEIPIKRNFVWVTIQIEDRNLHSPSFIQLHYETTTST
IAALGTELLQVRALDADRGFNGQVQYSLQAGNSESLFTIDPHLGIITVAQKLDLMQQDQY
MLTVRAEDQGSPPLHDVATVTIHIHPSDYSAPIFSMAEYFAEIPESVAIGSPLLLVSALS
TSEVTYEMREGNKDGVFSINSYSGLISTQKNLDHEKVSSYQLKVRGSNMAGAFADVMVLV
YIIDENDNAPVFINSSFVGQISEAAPIHSMILGEYHHPLVVRATDADTDANALLVYEILE
REALKFFKIDPSMGTLTTVMEMDYEHIPSFSFSIHVHDQGSPILFASKPARVTIHVKDVN
DSPPVFSEDAYEVMVLLPIHPGMELLQVQATDADSVVTYSIIAGNADDAVFIHPLTGLIS
VVDVALLGHSRDFTVKAFDGLHYDTSVVKINLTEALVTTLKFDQDVYTVTVKENSWDTQA
LIIMGVQGSQLNDTLSYSVLNGTDMFQMIQSVGVLQTKGVAFDREQQDAYVVAVEVRDDR
HPPRVAQAAVKISIEDVNDNPPEFRHLPYYTAIQDGTEPGDVLFQVSAIDLDIGANGAIT
YAFAEDYMYFWIDPYLGDISLKKPFDYRALNKYTLRVIAQDGGNPSLKVEENVLVTVRNK
SNPLFQSLHYKVRVPENIALYTPILHTQARSPEGLRLIYNIMEEESLTLFTADFKTGVLT
VTGPLDYESQTKHIFTVRATDTALGSFSEATVEVQVEDINDNPPVFSQLVYSALVSEGLP
PQTPVIQLLASDQDSGRNKDVSYWILEDDSEDSSFFQIDESSGEMSTTQELDYETQQQFY
VKVRAVDNGVPPLSAETLVIVNVSDVNDNPPAFRQPQYEANVSELATCGQLVIKVQALDP
DSGDTTRLEYLILSGNEDRHFTINSTSGIISMFNFCRKHLDSAYLLRVAASDGVFRTAVP
VYINTTNANKYSPEFRQHIYEVELAENAEIGTKVIELLAVDPDDGPYGTIDYTIINKLAS
EKFSINSRGQIATLQKLDRENPTEKLMPIKVMARDGGGRVAFCSVKTILTDENDNPPQFK
ASEYTVSVQSNVSKGSPVIQVLAYDADEGANADVTYSVDSVEDLADEVIEVNSATGVVKV
KESLVGLENQAFNFKIKAQDGGPPHWDSLIPVRLQVVPNEVTLPKFSEPSYTFSVSEDLP
EGSEVGLVKAVAEDPIIYSLVKGTTPESNKDGVFSLDQETGALTVKKAIDYETTKWYQID
VMANCSHQETGLISLVSVNIQVKDVNDNKPVFEADPYKAFLTENMPVGTTVIQVTANDQD
TGVNGEVTYSLALEQGNAAAELFAINSENGWITTLRELDCEVQEMYSFYVVASDHGRTIQ
LSSKALVEVTITDENDNAPQFASEVYRGSVIENGEPGEHVATLRTLDADISEQNRQVTCY
ITEGDPLGQFGISQTGDEWKITTKKTLDREHIAKYLLKVTASDGKFQASTPVEVFVLDIN
DNSPQCTKILYSSKVPEDVLPGHFILQVTATDLDTGVNALVTYSLHGPGADEFKLDPYTG
ELTTLMLLDREEKDVYYLVAKATDGGGRSCQADVTIRVEDVNDNAPRFFPSHCSVAVFDN
TTVKTPVAVVFARDPDEGINAQVSYSLVGSADGHFSIEATTGVVRLEKPLQAMQQEVLEL
IVRASDQGTPTPLSTLGTITVSVVDLADYLPVFLNTEHNVQVPEDAQPGTEVLRLSPLTR
EGAEKMGYQIVSGNEREKFRLDYHTGILYVNGSLDFETSQEYYLSIECSRKGSPSLNDGT
MVVVNVTDVNDHPPKFPQDVYSVEVKEDVAVGETILTVSAVDGDGPLNSAITYSLVAGDQ
LGHFTIHPKKGELQIAKHLDWEETSSYSLTLRATDSGQPVLYQDAVVNVEVADVNDNPPR
FFQLNYSIVVQENAPLGSRVLELVLSDRDSTKNGPPYSFHITEGNDGSAFRVTDDGWLVT
AAVLNRKFKEQYLLQIQVTDSGVPPLSSSAFVNAQVTEQSQYPPSALPLEIFITTGEQIF
QGGVVGKIHATDQDPRDTLTYRLMEKKPIRSHFSVGIADGKIIANEGLPHGHYNLNINVS
DGTFVALAGVHVHVWHAAPEAQARAVLLQFRHLSPEEFVGDHWRNLQRFLGSALGFERQH
IYPVSLQPAEEMVGIDILLAFEEALGSFHEPRSLSDSIARLAREIEHSVGIHMTKVAPVA
LCQGPGCQEHICTETLQLDSGAMSTYSTARISILTPKYSLRVNCSCNDTAARFSSQSSVQ
YQRPFARDWHIFQLKTQQPDASLLFLNWSTVAFLELTDGMPHLEYHCPGGFQGNLSSMYF
VSDQEWHLVLLVVTGASIRLLIDGKGNASTVLPEHCWSPQFGGDLFLGGRIRPHLLQQTS
RAFRGCVNDITVNGEELELLSNKQKKGAGFLKAKALTQCCPQSSVCMQNPCLNGGQCSET
YRGGYKCLCPASFSGDHCELGRGSCESRPCLNEGKCLLKPGGAFCSCVYPYTGERCEEMA
ECPNGPCETTTQTTAHQERGYGQQEIKVIAVGVACAVLIIIVFMVLCYYCHPDKTHRPVA
KDDPDLFAKSVGVDTQTMPIELNPLDTGSHNNLDCAGPEAHKASVAPEFLTFGPGPGQRQ
RSMIVCSVAPNLPPAAPPSNSDNESIIKSTWAGEEMVYPAEATFWAPSYAPAELQEYSRY
EVMQGPMPASPHRGPPPPADPEPPALYGGFPFPLESANKRAPIPPRYSNQNLEDFLPLQP
PSPDPRERPHSPCPNEYTAISYYPSHLLQPGGPLYPTEGAYKRVSVRLSVAQPSYADCEV
VPCPPGRPLHYEGSDMVESDYGSCEEVMF
Download sequence
Identical sequences F6UD14
ENSMODP00000031363 ENSMODP00000031363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]