SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031454 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031454
Domain Number 1 Region: 83-141
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000144
Family AN1-like Zinc finger 0.0018
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000759
Family AN1-like Zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031454   Gene: ENSMODG00000023735   Transcript: ENSMODT00000033027
Sequence length 145
Comment pep:novel chromosome:BROADO5:3:484553184:484553618:-1 gene:ENSMODG00000023735 transcript:ENSMODT00000033027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLEKHCSEESCGQLDYFPLECDGCNKAFCKDHHKSSRHKCSDAYKKDVQVPVCPLC
WAPVPVGRGKIADIVVGKHMDGDCKYNPAKEKPKIFIHRCSKEGCEKKEMFKLVCEQCQD
NFCIKHRHPLAHNCKHRDHPISKAG
Download sequence
Identical sequences F6X8V4
ENSMODP00000031454 13616.ENSMODP00000031454 ENSMODP00000031454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]