SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031499 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031499
Domain Number 1 Region: 346-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-50
Family SPRY domain 0.000019
Further Details:      
 
Domain Number 2 Region: 50-161
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-18
Family V set domains (antibody variable domain-like) 0.00036
Further Details:      
 
Domain Number 3 Region: 175-251
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000532
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031499   Gene: ENSMODG00000010314   Transcript: ENSMODT00000033072
Sequence length 530
Comment pep:novel chromosome:BROADO5:1:336860842:336872100:1 gene:ENSMODG00000010314 transcript:ENSMODT00000033072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLLVFMNRFKDMFNISTLSFFQVSKTFKHHLLLMFVVSLIDLGSGHFQVIGPDKPIQT
LVGEDILFSCHVSPMLNLENMEVRFFRNQFSSLLVLYKDGKETKERQMQEYQGRTQFVQD
AIPEGRVSLKLKNIILSDAGIYGCRFSSQTFYQEYTWELQVAALGSTPLISLEKYITSGI
LLKCQSTGWFPKPTVQWKNHQGKHLSSDFKANTRDDGLFDIETSLTIQESSIGDISCSIH
TWELRKESRVRIADPFLQPSPWIYGFSIMLAIVLIVAVYGVFLHIRKGEKWEKKVREELV
LGLAWSTWFLAKSGPISYLVLGFSFPSLPPVEVTHRYFLRYFVLCLYFQVEVTLDQETAN
PLLQISEDCKTVSYNDTSMVVSMPENEKIFHSPCVVASQGFYMGECYWEVEVGKKNRWYL
GVCLDSVNRKEKLPKLNPANGYWVLGRWNQYEHFVFSPNRQILTLQVHPMKIGIFLNYKY
GQISFFNVTNKSHIYTFTGCNFNGKILHPYFRPRSNDIQEPSYPLTICTK
Download sequence
Identical sequences F6WRA2
ENSMODP00000031499 ENSMODP00000031499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]