SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031556 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031556
Domain Number 1 Region: 440-566
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-29
Family Cadherin 0.0023
Further Details:      
 
Domain Number 2 Region: 229-344
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-28
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 340-443
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-25
Family Cadherin 0.0067
Further Details:      
 
Domain Number 4 Region: 125-233
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 30-107
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000286
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031556   Gene: ENSMODG00000023761   Transcript: ENSMODT00000033129
Sequence length 797
Comment pep:novel chromosome:BROADO5:1:333233775:333245182:1 gene:ENSMODG00000023761 transcript:ENSMODT00000033129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPQKLWHYRGRILLCFLLGSLWETGAVQIHYSIPEEMEKGSFVGDIAKDLGLEPHKLS
ERGARIVSGGKQHFALNVKSGSLITAERIDREKICLGISSCLLNVEILMEDKVKIYGLEI
EVMDINDNAPRFRTDEVEIKINENAAPGIRFGLPSARDPDRGVNSLQSYQLSQNKHFSLN
VLSGIDGAKYPELVLERALDREEESVHQLILKALDGGDPGLSGTARIRVLVLDANDNAPV
FTQSMYSVSVRENVPKGTLLLAVNATDSDEGINGEVTYSFRNIDDKASEIFQLNSRTGKL
ILGEPLDYEESKIYEMEIQGEDGGGLLTSAKVLVRVLDVNDNPPEVMVTSFSSSIPENSP
PGTVIALLKVHDRDSGNNGHITCSIPGHLPFKLEKSYANYYSLVTDRILDREQASMYNVT
VTAIDQGTPLLSANTHISLQVEDINDNPPHFSQTSYSAYIPENNPRGSSIYSVIATSDLD
SGENAHITYSIEEETIHGTPLSSYVSINSETGVLYALRSFDYEQFRDMQLRVIARDSGNP
PLSSNVSLTLFILDQNDNAPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDGDSGK
NAWLSYRLLKATEPGLFSVGLHTGEIRTTRAFHDKDSLKQSLVVAVTDNGEPRLSATVSV
TVAVADNIPEILSDLSSLKDPEDQQDSSLTLYLVISVAAVSCLFFVFIIVLLALRLHKWR
ISKVLESCNGHFAGVPASQFGGIDGVRTYLKTYSHEVSLTMDSQKSQMLFPQPNYADTLI
SQESCEKRDSLLVPNCM
Download sequence
Identical sequences F6SWZ2
ENSMODP00000031556 13616.ENSMODP00000031556 ENSMODP00000031556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]