SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031560 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031560
Domain Number 1 Region: 425-551
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 219-324
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-27
Family Cadherin 0.00057
Further Details:      
 
Domain Number 3 Region: 324-428
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-25
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-21
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 542-652
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-17
Family Cadherin 0.00086
Further Details:      
 
Domain Number 6 Region: 13-88
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000571
Family Cadherin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031560   Gene: ENSMODG00000023764   Transcript: ENSMODT00000033133
Sequence length 757
Comment pep:novel chromosome:BROADO5:1:333162094:333164364:1 gene:ENSMODG00000023764 transcript:ENSMODT00000033133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFLLGLLWDTLTAQIRYSIPEEMEKGSFVGDIAEDLGLELQELSERGARIVSRGKKQHFA
LNVRSGSLITVDRIDREELCSQRVQCLLNFNILIEHNLNIYSVEVEITDINDNAPRFRAE
ELELKISETTTPGTQFILESAYDPDVGVNSLQGYELSPNHHFSLRVQSGADGIKYPELVL
DRALDREKEPTLQIVLSAWDGGEPIRSGTARIRVTILDVNDNAPVFTQPIYSMNVPENVP
QGTVLLTVNATDADEGINSQVRYFLVKIPGKNSEIFQLNSETGELLTLQNLDYEDERFYM
MEAEAQDGLGFWSRAKIHVTVVDVNDNAPEVTITSVTSSIPENAPPGTIITLFHVHDRDS
GKNGQVLCSIPDDLPFKLEKKVDNYHSLVTDRALDREQVSEYNITVTAVDFGSPPLSTDT
HIFLHVADINDNPPTFSQSAYSAYIQENNPRGASIYSLTAQDPDSQENALVTYSLVDSNL
PLEAPPLSSYVSINSETGVLYALCSFDYEQSQELQLRVTARDSGDPPLSSNVSLTLFILD
QNDNAPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADSGQNAWLSYHLLKATEP
RLFSVGLHSGEIRTVRAFLDKDALKQNLLVAVTDNGEPPLSATISVTVAVADSIPEILSD
LSSHPAPESQDDSLLTFYLVIAVAVVSCLFFTFIVLLLALRLRKWWMLQVVQSAADHVGG
VSSSQFLGIDGVRAFLQTYSHEVSLTMDSRKSQLFFP
Download sequence
Identical sequences F6SEW5
ENSMODP00000031560 13616.ENSMODP00000031560 ENSMODP00000031560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]