SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031625 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031625
Domain Number 1 Region: 311-436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031625
Domain Number - Region: 260-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 287-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00775
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031625   Gene: ENSMODG00000013665   Transcript: ENSMODT00000033199
Sequence length 569
Comment pep:novel chromosome:BROADO5:4:383161731:383167798:1 gene:ENSMODG00000013665 transcript:ENSMODT00000033199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRWGGSLLGTLTSCFLLLPKVRGAGVFELQVHSFRPGPGSPGSPGSPCGARSSCRLIFR
VCLKPALPDLSPELPCALGAALSTSGSPGPGDPTDPGPQLSLADGLIRVPFRTAWPQAAL
CLVFLPQPRNPGALIFGDTPLFSPASNSGTLRDAPASLQPRNRASALEGMCKRQNSCMPG
KMTHIRDPRSEPERGAASTVKLCKDMEVGRKSKTGEELSLNLERLKGSISGWKEMGVPTA
SARFELCPLTVLNSSPIPFCFQEVAGDFECTCPRGFYGKRCEVIGMTCADGPCFNGGTCV
DGGAPAGYTCRCPPGFHGSNCEKKMDRCSLQPCRNGGLCLDVGRAVLCRCRPGFAGPRCE
RDLDDCAGRPCANGGTCVDGAHSFRCSCTLGFGGRDCRERADPCEPQPCAHGGRCYAHFS
GHVCSCAPGYMGARCEFPVQGAAPAPPPPGPHRGPPAATLPPALGLPFALLLLLAVVAGG
ATLLLRARRRSPGARPLPPSADPAPPTPPPADALNNLRAHERGPGHLKAPKHERTQRLLE
PQADDWCLPDDSDPRTIFIIPDSSLYGRE
Download sequence
Identical sequences F6WPQ3
ENSMODP00000031625 ENSMODP00000031625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]