SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031779 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031779
Domain Number 1 Region: 320-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-71
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 17-92
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-23
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 101-162
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-17
Family B-box zinc-binding domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031779
Domain Number - Region: 145-239
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0929
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031779   Gene: ENSMODG00000015977   Transcript: ENSMODT00000033354
Sequence length 503
Comment pep:novel chromosome:BROADO5:2:266772003:266779070:1 gene:ENSMODG00000015977 transcript:ENSMODT00000033354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTGLIEAGASAASAATALENLQVEASCSVCLEYLKEPVIIECGHNFCRACITRWWEEL
ERDFPCPVCRKTSRYRSLRPNRQLGNMVEIAKQLQAVKRKTRDESLCPQHHEALNLFCCE
DQEPVCLVCEISHAHRAHTIVPLDDAAQEYKEKLQKCLEPLEQKLQEITQCKSSEEKKPG
ELKRRVETRRQQIAGEFEELHRRLEEEQQLLLSRLEEEEQDILQRLRENAAQLGEQRRDL
ARLAAEIEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSSFPRQYFALRK
ILKQLMGDDFRENLEKIEPSKRDVTLDPETAHPNLVLSEDRKSAKFVETRLRDLPDTPRR
FTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCQDSVSRKGELTPLPETGYWRVRLWN
GDKYAATTSPFTPLCIKVKPKRVGVFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF
YPGIRAGRKNAAPLTIRPPTDWE
Download sequence
Identical sequences F6QKN2
ENSMODP00000031779 ENSMODP00000031779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]