SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031781 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031781
Domain Number 1 Region: 174-436
Classification Level Classification E-value
Superfamily Caspase-like 1.05e-87
Family Caspase catalytic domain 0.00000000253
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-26
Family Caspase recruitment domain, CARD 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031781   Gene: ENSMODG00000003612   Transcript: ENSMODT00000033356
Sequence length 438
Comment pep:novel chromosome:BROADO5:4:376079189:376111441:1 gene:ENSMODG00000003612 transcript:ENSMODT00000033356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESQRELFQKNRLRLVCELQVEPLWDLMLDRELFTRDMIEDIQRAGTRRDQARQLVTDL
QTRGKRALPIFISCLEATGQWDLAALLSESNTTLTQQPDPIDIKPVEMIRSGGLRSTEAF
LRNKQSTSLTDMKLPIKPLVPGSYTSKKDVPQGNNRNTAGSEKGQCLDSQTMRNDVVYTL
NSDPCGYCLIINNVDFCASSGLSSRKGSNIDCEKMHNRFQALHFAVEVERNLSAKGMGAA
LQQLAERDHSALDCCVVVILSHGCQASHIQFPGAIHGTDGASISVERIVNIFSGSRCPSL
GGKPKLFFIQACGGDQRDHGFQVSSNIPEDKSPGSDPETDATPFQNNFDQPDAVASLPTP
SDILVSYSTFPGFVSWRDPKSGSWYIETLDRVLEEWADREDLLHMLLMVSNAVSARGTYK
QIPGCFNFLRKRFFFKTK
Download sequence
Identical sequences F6QK70
ENSMODP00000031781 ENSMODP00000031781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]