SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031792 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031792
Domain Number 1 Region: 434-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-25
Family SPRY domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.67e-22
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-20
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 4 Region: 97-156
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000778
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 364-426
Classification Level Classification E-value
Superfamily ARM repeat 0.0000633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031792   Gene: ENSMODG00000015993   Transcript: ENSMODT00000033367
Sequence length 537
Comment pep:novel chromosome:BROADO5:2:266547725:266589130:-1 gene:ENSMODG00000015993 transcript:ENSMODT00000033367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAPLRTLEEEVTCSICLDYLRDPVTIDCGHVFCRGCVIDIRAPPGGRPSCPLCKKSF
KKDNIRPVWQLASLVQNIERLNVEKGKEAKEKRPEPTTMMQCERHKEKLHYYCEDDGRFL
CVMCRESREHKYHTAILIEKAAQPHREKILSHLGTLRRDKERVQSFQMKGETEIQHLLTK
LQMERQNIVSEFAQGHQFLRDREQHLLERLEGIEREIIEGREKYNLRTSGEVTRLGAVIS
ELEGKAQQPAAELMQDTRDFLIRYPRKKFWSGKAIAPAIRKRTGEFSDKLHSLRKGLREF
QGKLLRVLEYKTVNVTLDPQTASGYLILSEDWKSVSFTNIYRSLYQHPQQFDPEPAVLGS
KGFTWGKVYWEVVVEREGWGEEEGEEEEEGEEEEEEEENGYGEAEEDWETDEDDDSGGDD
DEDDLEDDDVIQESCLVGVARDTVRKKGELRLSPEDGVWALRLSSAGVWVNTNPEAELFL
AQRPRRVGIALDYDGGTVTFTNAESQELIYTFSASFTRRLVPFFWLNWLGTSLILKP
Download sequence
Identical sequences F6Y6M0
ENSMODP00000031792 13616.ENSMODP00000031792 XP_001368348.1.35504 XP_007483536.1.35504 XP_016286422.1.35504 ENSMODP00000031792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]