SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031812 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031812
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000349
Family p120GAP domain-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031812
Domain Number - Region: 222-326
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031812   Gene: ENSMODG00000014594   Transcript: ENSMODT00000033386
Sequence length 346
Comment pep:novel chromosome:BROADO5:3:477964750:477971410:-1 gene:ENSMODG00000014594 transcript:ENSMODT00000033386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFMNDFLEQHSSAMQRFLVQVASGDGDRAPRGYQGSGDLARGLAILHIQLRTIFSDLDQ
PTQESLEPLPTILQAIEEGRPVPVSVSMQPCATNIRAQVHASFSDKPGFLAPRDLSKHTP
LISKSQSLRIIQGRGRGEEQPVKRPHRRIQRTQSVPASRTANSHTSGPLSQAKPKDSLRR
GSQPQGGSRLGVSASLPRKSSVPWQRFLEKPHEMDHSICSHRLPGKLAELRQEIVSLREQ
QRVLAGQLKTLANKTQALGEQQKKLLGQLEEIQGQFKTRAQKLDPGHSPGLQSKSSENTR
MESLENRLADLERAHTQLVHWMQDQQKAPKMQLQLLKMPCTNGDAT
Download sequence
Identical sequences F6VA23
ENSMODP00000031812 ENSMODP00000031812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]