SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031832 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031832
Domain Number 1 Region: 316-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-43
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 8-86
Classification Level Classification E-value
Superfamily RING/U-box 6.06e-19
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 90-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031832
Domain Number - Region: 191-224
Classification Level Classification E-value
Superfamily ROP protein 0.0183
Family ROP protein 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031832   Gene: ENSMODG00000016017   Transcript: ENSMODT00000033406
Sequence length 485
Comment pep:novel chromosome:BROADO5:2:266487127:266499319:-1 gene:ENSMODG00000016017 transcript:ENSMODT00000033406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSATSLTTLEDEVSCPICQAILREPVTIDCGHNFCRGCLTHYCEIPGPDPGEQPICPL
CKDPFHPGGLRPNWQLASVVENIEKLKSAPPSGLGEDLCEVHEEKIYFFCEDDETQLCVK
CREALEHRTHTVRFLEDAADPYREQIHRCLESLKNEREDIQGIQSREDQRIQVLLTQVAT
KREKVILEFEHMCQFLERQQYLLLTQLEELDGDILKQKDEFESLVQGEICRFDALISELE
EKLERPARELLKDIRSTLIRQRGGCEGRRCRKPEAVSPDLGERIRDFPQQALQLQREMKT
FLENLLFELDCEPALISLDPRTSHPKLLLSEDYQRAQFSYKWQTSPDSPQRFDRAICVLA
QDGFVGGRHTWVVAVNPVHGGSCTMGVVNHDVRRKGELRLRPEEGIWAVRLAWGFVSALG
SYPTRLSLEENPKQIRVSLDYEVGWVTFINAVTQEPIHTFTASFTGKIFPFFGLWGRGSS
FSLSS
Download sequence
Identical sequences F6UR47
ENSMODP00000031832 ENSMODP00000031832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]