SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032212 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032212
Domain Number 1 Region: 11-151
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.93e-37
Family Gelsolin-like 0.0000113
Further Details:      
 
Domain Number 2 Region: 388-528
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.38e-35
Family Gelsolin-like 0.00000535
Further Details:      
 
Domain Number 3 Region: 260-444
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-30
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 4 Region: 514-613
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.03e-20
Family Gelsolin-like 0.00015
Further Details:      
 
Domain Number 5 Region: 598-728
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.57e-19
Family Gelsolin-like 0.00012
Further Details:      
 
Domain Number 6 Region: 142-177
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000625
Family Gelsolin-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032212   Gene: ENSMODG00000014211   Transcript: ENSMODT00000033789
Sequence length 728
Comment pep:novel chromosome:BROADO5:8:311195166:311232437:1 gene:ENSMODG00000014211 transcript:ENSMODT00000033789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPNMAPELYHKEFAVAGQKPGLQVWRVEQLDLVPVPVQQHGSFFVGDAYLVLYTAAGPRQ
GFFYRLHFWLGKESSQDERGAAAIFTMQMDDYLGRKPVQCRELQGYESTEFVSYFKGGIK
MKANGGVASGFHHVITNDLTAKRLLHVKGRRVVRATEVPLSWESFNMGDCFIIDLGMVSE
TRKKESCGASMAEPAFFPLPQTPLSLNMDKSQKGNSQFIDIQAGSSPSSSLAAKAVLGNK
PQLREGDVDADYEADNTNRRMARLYMVSDASGAMQVSLVAEENPFSMDVLRSEECFLLEH
LAAQQIFVWKGKDANPEERKAAMNMAEEFLQDMGYPPSTHIQVLPEGGETSIFKQFFRNW
RERDQSDGFGKVCVTEKVARVPQIPFDAQRLHASPQMAAQHHMVDDGSGSVEIWRVESNG
RVQVDPQTYGEFYGGDCYIILYTYSKGQIIYTWQGAHATRDELVHSAFLTVQLDRSLGGT
PVQVRVSQGKEPAHLLSLFKDKPLIIYKDGTSRKGGQTPPAPTRLFQIRRNLGSITRIVE
VELDADSLNSNDVFVLKLPRSGGYTWVGKGASAEEERGAEYLKGVLRCQTTRVPEGQEPA
EFWEGLGGKKPYQTSPLLESPACNHPPRLFGCSNKTGRFLVTSRGGQDGAPPLDGRRACG
FPLSGQIFLWIGKDANEVERSESIKSAKAYLETDPSGRDQRTPVVIVKQGYEPPTFTGWF
LGWDAHKW
Download sequence
Identical sequences F7FYC9
13616.ENSMODP00000032212 ENSMODP00000032212 ENSMODP00000032212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]