SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032263 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032263
Domain Number 1 Region: 169-241
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.22e-30
Family AN1-like Zinc finger 0.0000506
Further Details:      
 
Domain Number 2 Region: 51-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000077
Family A20-like zinc finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032263   Gene: ENSMODG00000004426   Transcript: ENSMODT00000033842
Sequence length 246
Comment pep:novel chromosome:BROADO5:3:453714130:453736800:-1 gene:ENSMODG00000004426 transcript:ENSMODT00000033842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRVRAASRVRDTWGNRPREGNSLAQVYTNRAELSTAMAQETNQTQVPLLCTTGCGFYG
NPRTNGMCSVCYKDFLQRQQNSGRISPSVASSPSPAALETFPVAYAEEADPTPDDVLARS
SSQTPVTHQMTAMSISKEDSQSKTVSYAQSDEAISTTPSSGSLLETSQSSSEEEKSSEKS
KPKKNRCFACRKKVGLTGFDCRCGNLFCAMHRYSEKHSCPFDYKAEAAEKIRKENPIIVA
EKIRKL
Download sequence
Identical sequences F7FLP4
ENSMODP00000032263 ENSMODP00000032263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]