SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032409 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032409
Domain Number 1 Region: 131-370
Classification Level Classification E-value
Superfamily vWA-like 8.26e-69
Family Integrin A (or I) domain 0.000002
Further Details:      
 
Domain Number 2 Region: 1121-1306
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-38
Family Fibronectin type III 0.00000582
Further Details:      
 
Domain Number 3 Region: 1499-1699
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 989-1107
Classification Level Classification E-value
Superfamily CalX-like 1.83e-18
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 5 Region: 627-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000017
Family Integrin beta tail domain 0.0032
Further Details:      
 
Domain Number 6 Region: 30-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000136
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 540-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.026
Further Details:      
 
Domain Number 8 Region: 582-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032409
Domain Number - Region: 509-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032409   Gene: ENSMODG00000007605   Transcript: ENSMODT00000033991
Sequence length 1801
Comment pep:novel chromosome:BROADO5:2:213271343:213322439:-1 gene:ENSMODG00000007605 transcript:ENSMODT00000033991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRMPWPGAWAGLLFWAVLWVSFQGSPANRCKKTLVKSCTECIRIDKDCAYCTDETFKD
RRCNTREELLALGCEAGSMMFRESSFQITQHAEIDTTLKKSQVSPQAMQLLLRPGEEQSF
EFQVFEPLESPVDLYILMDFSYSMSDDLANLKQMGQNLAQVLSSLTNDFTIGFGKFVDKV
SVPQTDMRPDKLKEPWPNSDPPFSFKNVISLTKDVEEFRNKLQRERISGNLDAPEGGFDA
ILQTAVCTKDIGWRKDSTHLLVFSTESAFHYEADGANVLAGIMKRNNEDCHLDSTGTYTQ
YNQQDYPSVPTLVRLLGQYNIIPIFAVTNHSYSYYEKLHTYFPVSSLGLLHEDSANIVEL
LEEAFRRIKSNLDIRTLNVPRGLRTEITSERYMKTKTGSFHITRGEVGTYHIQLRAMEHI
DGKHVCELPLEDQTGEIHLKPSFSDGLKIDAGIICDVCLCERQSEPLSAKCNFNGNFTCG
HCMCKEGWSGKTCNCSTGSTSDTKPCIRDGDDKVCSGRGECQCGRCVCYGDSRYDGQFCE
YDNFQCPRTSGFLCNDRGRCSMGQCVCERGWTGKSCECPLSNATCIDSNGGICNGRGHCE
CGRCHCDQVSLYTDTTCEISYSAVPLGVCEDLRSCVQCQAWGTGVKKGQKCDSCNFRVKM
VEELKKAEEVMEYCSFRDEDDDCTYSYTVEGNEAIGANSTVLVHKKKDCPGSFWWLIPLF
LFLLLLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYVLRENLMASDHLDTPM
VRSGNLKGRDMVRWKINNVQSTGLTTHAANPKELVPYGLSLRLARLCTENLLKPDTRECE
QLRREVEENLNEVYRQIPGVHKLQRTKFRQQPNAGKKQDHTIVDTVLMAPRSAKLPLLKL
TEKQVSQGAFHELKVAPGYYTLTSDQDARGMVEFQEGVELVDVRVPLFIRPDNDDDEHLV
VEAIDVPMGTATIGRRLVNITIIKEQASGIVSFDHPEYSFNHVDQVARIPVVRRIIDNGK
SQVSYRTQENTAYPNRDYIPMEGDLLFQPGETRKEIQVKLLDLQEVDALLSGHQSRRFHI
HLTNPKYGARLGDPHSATILIESQDKELFGQSSLYSTRSDPSAPQNPNAKAVGSRRIHFN
WLPPPGKPSGYKVKYWIQGDSESEAQFLDCKVPSVELTNLYPYCDYEMRVCAYGPMGEGP
YSTLVSCRTNEEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNEDNKP
IGPMKKVLVDTPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI
PIIPDIPIVDAQGGEDYDSFLMYSDDVLRSPASSQRPSVSDDTEHLMNGRLDFAFPGSAN
SLHRMTTTTSAYGTHLSPHPQHRILSTSSTLTQDYHSLTRTEHSSTLPRDYTTLATVSSY
GLPPIQEDGGSRYPGAQVTEPKDPVQVKGFHSYRGFQDSVILARPATHTWGPESRLPSGV
PDTPTRLVFSALGPTSLKVSWQEPQCDRALQGYSMEYQLMSGGELKRLHIHDPHQTSVVV
EDLLPNHSYIFRVRAQSQEGWGPEREGVITIESQVHPQSPHSPLPGSTFTLSTPSAPGPL
VFTALSPDSLQMSWERPRRPNGDILGYLVTCEMAQGGPSTTFQVEGDSLENRLTVPGLSE
NIPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPKLGGRLGLQQEPAQHQFPREYSSIT
TTHSSITKPFLADGLALETQHLEAGGSLTRRHVTQEFVSRTLSSSSSGTLTKQVERQFFQ
T
Download sequence
Identical sequences F7F799
ENSMODP00000032409 XP_007482704.1.35504 ENSMODP00000032409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]