SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032734 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032734
Domain Number 1 Region: 102-341
Classification Level Classification E-value
Superfamily Caspase-like 2.69e-58
Family Caspase catalytic domain 0.0000704
Further Details:      
 
Domain Number 2 Region: 6-89
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000612
Family Pyrin domain, PYD 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032734   Gene: ENSMODG00000010882   Transcript: ENSMODT00000034314
Sequence length 341
Comment pep:known chromosome:BROADO5:8:266334885:266349142:1 gene:ENSMODG00000010882 transcript:ENSMODT00000034314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPDMESFKAQVVSTLTKLSPEELRRFGIYLRNVGEEPRVSRHDLEMATKPEELADLLL
KRYVMTGTPRVLVQVLGQVPRKDLALEWESMSRMNLKRPYEDDSSELDRYNMDRTRKAFV
MCVKTGRPGAKQDISRIKNWLEKCKFEYTYCDDPDEEELFEKLTQFRDGINGIKEEVSCC
LVTLMAHGGKGHIKTKSNERVNLSDIFEMFNNENCPALQEKPKIFVIQACRGDKRDGGVV
QADDEPMELDLSEKKRLPTSSDYYIIYATQDDHVAFRHPRDGSVMIQAIDEVFRQHGKKW
HIADFFTQVNNLVVHTDFYINRNPAKVVLVMESTLTKAVYF
Download sequence
Identical sequences Q1WK33
ENSMODP00000032734 NP_001035238.1.35504 XP_007504520.1.35504 ENSMODP00000032734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]