SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032817 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032817
Domain Number 1 Region: 488-594
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-22
Family PDZ domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032817
Domain Number - Region: 666-765
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032817   Gene: ENSMODG00000012010   Transcript: ENSMODT00000034396
Sequence length 839
Comment pep:novel chromosome:BROADO5:2:203514895:203544228:-1 gene:ENSMODG00000012010 transcript:ENSMODT00000034396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEPRGPGGPLRSASPHRSAYEAGIQALKTPSDTPGADEAPKVPHHKKYGSNVHRIKS
MFLQMGTAGPPGGWGEGSSGAGGAGPPDPPPRVPERSVRLSLPRASSLNENVDHSALLKL
GTSVSERVSRFDSKPSQPAQPSLPPQPLSRLQETRKLFERSPAGAAAGPGGDKEAATRRL
LRQERASLQDRKLDVVVRFNGSTEALDKLDTDAVSPTVSQLSAVFEKADLRSGLHRGPGA
PPLNSKLVSKRSRAFLPTPPAPSADGPSEKERGSGGQPQPQGQPQQPLQRSAPVRPPPKP
REVRKIKPVEVEESGESEAEAAAGEVIQAEVTVHAALENGAVAVAVPAGPPEEQSAPAAL
EDEGDAERGVGGSGGSRAPDVAPEEGDESKREDFSEADLVDVSAYSGLGEDSGGSGLEEE
EEEEEEDDEEEDGEPPYEPESGCVEIPGLSEEEEPVPSRKIHFSTAPIQVSATCINESYK
PSFHNFQPLWKFLANVTDLSLLICLFADSEGLGISIIGMGAGADMGLEKLGIFVKTVTEG
GAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFLIGRERPGEQSEVAQL
IQQTLEQERWQREMMEQRYAQYAEEDEETGEYATDEDEEMSPTFPGSEMAIEVFELAENE
DALSPVEMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQGLEQEKGRWRAEKAQLEQSVE
ENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLK
KETAQRRVLEESELARKEEIDKLRDKISELEGNLQTXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences F7D2K5
ENSMODP00000032817 ENSMODP00000032817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]