SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033025 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033025
Domain Number 1 Region: 350-489
Classification Level Classification E-value
Superfamily C-type lectin-like 8.57e-43
Family C-type lectin domain 0.00024
Further Details:      
 
Domain Number 2 Region: 633-778
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-38
Family C-type lectin domain 0.00000342
Further Details:      
 
Domain Number 3 Region: 930-1079
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 4 Region: 785-922
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-37
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 5 Region: 1216-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-35
Family C-type lectin domain 0.00026
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.22e-33
Family Cysteine rich domain 0.00000222
Further Details:      
 
Domain Number 7 Region: 1088-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-31
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 8 Region: 499-637
Classification Level Classification E-value
Superfamily C-type lectin-like 2.92e-31
Family C-type lectin domain 0.00088
Further Details:      
 
Domain Number 9 Region: 230-343
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-28
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-19
Family Fibronectin type II module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033025   Gene: ENSMODG00000009695   Transcript: ENSMODT00000034604
Sequence length 1452
Comment pep:novel chromosome:BROADO5:8:256122634:256255573:-1 gene:ENSMODG00000009695 transcript:ENSMODT00000034604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSLLLLFLSLTCAASQLLDTKQFLIYNEDHKRCVNVINANSVQTAPCNSESEAQKFRW
VSNSQLMSVSLKLCLGVTSKIDWVPITLFPCDSQSDLQKWECKNDTLFGIVGEDLYFNYG
NKQEKSVMLYKGSGLWSRWKIHGTSDNLCSRGYEAIYTLLGNANGAPCVFPFKFGDNWYA
DCTSAGRSDGWLWCGTTADYATDRLFGYCPMKFPGSESLWTKDPLTGISYQINSKSALTW
HQARKSCQQQQSELLSITEIHEQTYLTGLTNSFTTGLWIGLNSLNFNSGWQWAGFSPFRY
LNWLPGNPALEPGKSCVFLNPAKNAKWENVECSHKLGYICKKGNSSLNSFVIPSESDVPI
SCPSQWWPYAGHCYKMNKEQKIQKDALTACRKEGGDLASIHSIEEFDFIFSQLGYEDTDT
LWIGLNDLKIQMYFEWSDGTPVTFTKWMPGEPSHANNRQEDCVVMTGKDGYWSDHPCENS
FGYVCKTKPASKPPVIEVEEGCQKGWKRHGLYCYMIGQTLSTFPVANQTCISQKAYLATV
EDRYEQAFLTSFVGLRPEKYFWIGLSDVENKGTFKWTIDENVQFTHWNSFMPGRKSGCVA
MKTGVAGGLWDVLKCEEKAKFVCKHWAEGATPPPVPTTTPAPKCPDGWISSAKTNFCFKI
FDKSKYSKKTWFDARDFCRAIGGDLASITNKEDQSTLWQNIGSSNYHDVFWLGLTIANTD
EGFTWSDGSPVTYENWFYGEPNNYGNVEFCGELKADPSMRWNDINCELLRNWICHIKKGD
ELKPEPTPSPESQPSVTEDGWVIYKDYQYYFSKEKSTMEDARAFCKRNFGDIVTINGESE
RKFLWRYASALDSETTYFIGLLISLDKKFIWMDGTKVNYVAWAPGEPNFANDDENCVVLY
TSSGSWNDINCGYPNAFICQRHNSSINATASPTPALPLGGCRGGWKLFENKCYRFFGFKE
DERKNWQNARKDCQSSGGNLVSIHSAKEQAFIITQLRGSTHDSWIGMNDINSENKFLWTN
GRGVKYTNWAKGFPAGRRSLLSYEDVDCVVVVGGTSLESGKWVDEICENEKGYICQTDSD
PSLPHSLPPTPSEGFIEYGDSSYSVVPSKMKWKDADEYCKDKSSQIASILDSYVNSFLWL
EVIKNNEPVWIGLNSNLTQGEYAWTDRWRMRYTNWASGEPQLKSGCVYMDLEGFWKTAPC
NESYQFLCKKSDVIPHTEPPQSPGRCPDSEHISWIPFHRYCYYIESSSSRSWGQSLLECN
RMGASLVSIESAVESSFLKYKVEPLKSKTNFWIGMFRNVEGNWLWINNDAVSFVNWKAGE
PSGERNEDCVELYSSSGLWNNLYCSSYRGFICKREKIIDVQSTQALPRKEDVPEKRNAPK
SHSSAGIIVVVVLLILTGAAGAAYFLYKKRQVRPSQGGNFDNTLYFNTGSPRETSDTKDL
VGNIEQNEHALI
Download sequence
Identical sequences F6Y2F6
ENSMODP00000033025 ENSMODP00000033025 XP_007504974.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]