SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033504 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033504
Domain Number 1 Region: 1-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-84
Family L-arabinose binding protein-like 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033504
Domain Number - Region: 410-457
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0115
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033504   Gene: ENSMODG00000020251   Transcript: ENSMODT00000035082
Sequence length 742
Comment pep:novel chromosome:BROADO5:5:297042856:297071904:-1 gene:ENSMODG00000020251 transcript:ENSMODT00000035082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQNFLTVQFTVDEINNDPHLLPNISLGYQLLNNFHESGLAVENSLMWLSGKGPTIPNYSC
DRQHKSIVVIGGMSSTLSMAMATLLGLYKVPQLSYGSFDLLLSDEVLYPYVYQLGSREST
LHLAAVQLMLHFGWTWVGLIFSGDLTGEQFSKHLKDEMTWNGLCLAFTEQVSEKFKQGDD
DIKFLARILGSSSNVIFIYGNTASLKFFSELLMIFAFYGKMFVISASWDFSAYSDDEMMS
NFHGTLIFSQFKREIPGFIDFLKSSYWEIVFHCLLSERKNLNMTSQQCDESLTFADVPPI
FFDKTTKEESSNIYNGVYLLAHTLHQMLQTEAKDLSELLAYPLLSWKSVARSTERYHTMK
GREGDQIIGAKVLGIFGRMWNKEHMLKIISVSPGLVDLFDLVLDWHYAIPSSTCSVACGP
GFRKQFREGQPICCFDCTLCPDGKFSNKTDAEECIQCPEDQYPSQEKDRCLPRTVTYLAY
EETLGMILTSAAFCFSILTIFVLRVFVIHRDTPIVKANNRSLSYILLTSLTLCFLSSLLF
LGRPTPAICILRQTTFAIVFTVAIASILAKTITVVLAFRATKPGSKLRRWLRPAVSHSLI
FLCTLIQMFLCSIWLGTYPPFFEMDTHSEASFIVIQCNEGSLVTFYCVLGYMGFLALVSF
TLAFLARNLPDTFNEAKYLTFSMLVFCSVWISFLPAYQSTKGKAMVAMEIFSILVSSAGI
LICIFAPKCYVILLRPDRNTLE
Download sequence
Identical sequences F6TKA1
ENSMODP00000033504 ENSMODP00000033504 13616.ENSMODP00000033504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]