SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033588 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033588
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-30
Family SPRY domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033588   Gene: ENSMODG00000024206   Transcript: ENSMODT00000035168
Sequence length 136
Comment pep:novel chromosome:BROADO5:5:294885405:294885894:1 gene:ENSMODG00000024206 transcript:ENSMODT00000035168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLNDNDKSVVSSSEKQDQSKCAEHFDTLVCVLGQERFDSGRRYWEVKIKWTLGLCREGE
IKHILQEEEKMSVEKTPETGFWTLCLKKGNMCQALSYPGISFQLEEVPQIVGIYLDYEAD
QISFYNVADGIHIYIF
Download sequence
Identical sequences F6RJ44
ENSMODP00000033588 ENSMODP00000033588 13616.ENSMODP00000033588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]