SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033593 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033593
Domain Number 1 Region: 275-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-64
Family SPRY domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 117-200
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000192
Family C1 set domains (antibody constant domain-like) 0.054
Further Details:      
 
Domain Number 3 Region: 4-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000866
Family V set domains (antibody variable domain-like) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033593   Gene: ENSMODG00000024207   Transcript: ENSMODT00000035173
Sequence length 445
Comment pep:novel chromosome:BROADO5:5:294865518:294879748:-1 gene:ENSMODG00000024207 transcript:ENSMODT00000035173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQFTVIGPAGPIVALLGKEITLPCDLYPLKNVEHVDIKWYRKRFLPGECLLEFIMIRKR
TSSFLFLFSQFNQHLLICCTQKMLWEPKINHCLVLYLSLLYLYMLLCLSFPAWGSDPQIH
VKPLKDGEILLLCQSNGWYPKPQVGWKDIQGENLPSLSESQSQDGEDLFQTETSLVVQSN
STEDVFCFLQHPLLEEQKIVKPPPRVSFFLRKCVWVVAFAAAFLIVGLFILGCIYCIWKR
RCAKDLLINEKASRQSHSEFWRVVSRLQRFIVVSLFIVDVILDPATAHPILIVSEDQSQV
THGDAEQDVPKTNQRFDSRPCVMGSKGFTSGRYYWEVEVGTGASWTLGVCREAVSKKGWL
ALSPEEGFWTMRLQKNHYEALSSPVTPLSLTTSFSRVGVYLDCEVKEVSFYNVTDRSHIY
TFPNCSFSGAIYPFFWVSPGAPLIL
Download sequence
Identical sequences F6RJ00
ENSMODP00000033593 ENSMODP00000033593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]