SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033729 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033729
Domain Number 1 Region: 210-455,486-505
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.32e-46
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 16-112
Classification Level Classification E-value
Superfamily DEATH domain 7.36e-28
Family DEATH domain, DD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033729   Gene: ENSMODG00000005480   Transcript: ENSMODT00000035312
Sequence length 648
Comment pep:novel chromosome:BROADO5:6:242934075:242991972:1 gene:ENSMODG00000005480 transcript:ENSMODT00000035312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQPPLLPPPPALRSPRTTQYIYQLPSWVLEDFCHKMDSLSEWDWMQFASYVMTDQTQL
RKIKSMERIQGVSITRELLWWWGMRQATVQQLLDLLYRLELYRAAQVILDWGAIPEIASA
SHVLPDSTHPGKSSLASLRKPEETQEKGLQKSSGLTPSSSSEPGPSGCSNRVLQLPFIED
DLPHSLKTNPSTSDIKNCHAYITQHQPLLSLNGESLYWTEMEVIKATNGFGQENKISQGT
FADVYKGQRHNITYVFKKLQKTRCPRNLSVESFFHMEVQICLRCSHQNILPLLGFCTGEV
FHSVIHPYMPNGSLEDRLRCQDNTDPLSWEQRISISLGFLGAIEYLHGLKIIHGNIKSSN
VLLERNFIPKLGHPRVRVSSNDKKSSYTMMNTQLFQAVAAYVPEDFLRVGQLTERVDIFS
CGIVLAEILTSIPAMDKERTPVFLKDLLISEIPSPKTLLCSKNKCVEKLAAKEICQKYQD
AKAGYLPENCAVDFATAVYLCLQKKTPNLTQVCAIVAELNRQIRNPQSLLSPSGNSELKN
SSVNTPEETDDVDNVSVEGSSSDEPDKNGLWAGAGSSSPQPGYREGRCLTNGIEADSSVG
PGPSHPQDATETSWEVEVNDAKKKLMENILLYEEEKLNSKELFGSFEP
Download sequence
Identical sequences F7AID5
ENSMODP00000033729 ENSMODP00000033729 XP_007500279.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]