SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033981 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033981
Domain Number 1 Region: 29-199,233-399
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.58e-82
Family YicI catalytic domain-like 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033981
Domain Number - Region: 4-28
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0345
Family YicI N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033981   Gene: ENSMODG00000024400   Transcript: ENSMODT00000035567
Sequence length 408
Comment pep:novel chromosome:BROADO5:8:204819264:204836985:1 gene:ENSMODG00000024400 transcript:ENSMODT00000035567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLQPAPAVTYHIIGGILDFYVFLGNNPEQVVQEYLELIGRPFLPSYWSLGFQLSRRDYG
GIEGLTSVVNRTRAIKIPYDVQYSDIDYMEEKKDFTYDKEHFKGLDQFAEELHSKGQRYI
IILNPGISKNMSYGPYENGSRKRIWVSGATGPVIGKVWPGPSVFPDYTNPEGTQWWIDEL
VKFHEELNFDGIWMDMNEVADFLNNESLCEHNELNYPRFVPKILDRKLFAQTLCMDTEQH
WGLHYDVHSLYGYSMAIATAKAMENIFPKKRSFILTRSTFAGSGKFAAHWLGDNEASWND
LQWSIPGILEFNLFGIPMVGANICGFALNTSEELCRRWMQLGAFYPLSRNHNGPGLMDQD
PAAFGRNSVLLNSAIHYLNIRYNLLPYLYTLFFRAHFRGDTVARPLVH
Download sequence
Identical sequences F6Z3Y3
ENSMODP00000033981 ENSMODP00000033981 13616.ENSMODP00000033981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]