SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034022 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034022
Domain Number 1 Region: 129-404
Classification Level Classification E-value
Superfamily Caspase-like 4.78e-80
Family Caspase catalytic domain 0.000000048
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily DEATH domain 3.2e-20
Family Caspase recruitment domain, CARD 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034022   Gene: ENSMODG00000014752   Transcript: ENSMODT00000035608
Sequence length 405
Comment pep:novel chromosome:BROADO5:4:250130013:250142302:1 gene:ENSMODG00000014752 transcript:ENSMODT00000035608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKVLMEKRRLFVESVDRGVMNGLLDDLLEVQVLNLEEMEIVREESKTNRDKARVLIDA
VISKGPKASQCFTKSICERDGHLAEKLGLSSELNSNQSHISLCREQAPRPINICILRNDN
IERTTMNPGYLDTLKLCSYEDFQQKRKEMEGQIYPVMEKGFRTRLALIICNKEFDELPRR
NGAENDVTGMQNLLEGLGYRVHVKENLTALEMESALKQFASYPEHRTSDSTFLVLMSHGV
PGGICGKDYTDKVPQILDVNKIFQIFNTSNCPTLKDKPKIIILQACRGENDGVVWVNDSS
KSSQQRCSQNLPIFEDDAVRRAHVEKDFIAFCSSTPDNISWRNIYKGSLFIIQLILYIKK
FAWCYHLYEIFCKVQHSFETPAEKLQMPTIERATLTKYFYLFPGN
Download sequence
Identical sequences F7G5S9
ENSMODP00000034022 ENSMODP00000034022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]