SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034265 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034265
Domain Number 1 Region: 117-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000109
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 77-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 34-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034265   Gene: ENSMODG00000019832   Transcript: ENSMODT00000035851
Sequence length 359
Comment pep:novel chromosome:BROADO5:5:272194572:272502545:1 gene:ENSMODG00000019832 transcript:ENSMODT00000035851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESRGGRAMWLLGPLCLLLSRAGGDRLIPHDGGPVVCDQLRGRGPSNGRCIPGAWQCDGLP
DCFDKSDEKECPKAKSKCGLTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLC
STARFHCKNGLCIDKSFVCDGENNCQDNSDEESCENPQETGSGQTYATPENQLLYYPSIT
YAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHRCSVTY
NVNNGIQYVSNQVYHNSLDLESPPSYSEAVLDQSRPPWFDLPPPPYSSEGDSLSQTELPP
YRSRAGSSASCSPAADRGFLSISSSQPQDSSSSTSHPHSSPERTPEPSDSLLNSGTMED
Download sequence
Identical sequences F6SAK0
ENSMODP00000034265 ENSMODP00000024751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]