SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034270
Domain Number 1 Region: 473-778
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.15e-54
Family Eukaryotic proteases 0.00042
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-32
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 275-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000012
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 337-407
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 235-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034270   Gene: ENSMODG00000019829   Transcript: ENSMODT00000035856
Sequence length 778
Comment pep:novel chromosome:BROADO5:5:271513753:271629732:-1 gene:ENSMODG00000019829 transcript:ENSMODT00000035856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAFWTQVALTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGALDDFYVKGFYCAECRGGW
YGGDCMRCGQVLRVPKGQILLESYPLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNSDSRIIKRFCGNERPAPIQSTGPSLHILFQSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDKAGSYQCACLAGYTGKRCESLVMCKTPGVPAHGMVEGSDLRYGAQVY
FRCLPGYSLKGNRVALCQLDGSWTTHDPACVLEEKNCSDPGGPVNGYRRTSEGSGLINGR
YAKIGTVMSFFCNHSYVLSGNEQRTCQSDGEWSGKQPICIKACREPKISDLVRQRVLPMQ
VQSRETPLHQLYSATTFSKQKLDSYPTKKPALPFGELPPGYVHLHTQIQYECLSPFYRRL
GSSRRTCLKTGKWSGRAPSCIPICGKIENVTAPKTPGTRWPWQAAIYRRTIGLQDSSLHK
GTWFLICSGALVNERTVVVAAHCVTDLGKSIVIKAAELKVVLGKFYRDDDRDEKTLQSLR
ISAIIVHSNYDPILLDSDIAIVKLLDKARISSRVQPICLAALRDFSPSGEDTQITITGWK
ILADVRAPGFKNDSLRSGVVKVVDSLLCEQQYEDHGIQVSLTDNMFCAQQDPIAPSNICP
AETGGIAAVSLPGKASPEPSWHLMGLVSWGYDKTCSLNLYTAYTKVLPFKDWIEKNMK
Download sequence
Identical sequences F7GFL5
ENSMODP00000034270 ENSMODP00000034270 XP_016278966.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]