SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034465 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034465
Domain Number 1 Region: 524-874
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-105
Family Calpain large subunit, catalytic domain (domain II) 0.0000129
Further Details:      
 
Domain Number 2 Region: 71-96
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000785
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number 3 Region: 190-217
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000155
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number 4 Region: 110-135
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000471
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034465
Domain Number - Region: 486-511
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000388
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Domain Number - Region: 406-431
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000942
Family Ran binding protein zinc finger-like 0.0052
Further Details:      
 
Domain Number - Region: 355-382
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00215
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034465   Gene: ENSMODG00000016682   Transcript: ENSMODT00000036053
Sequence length 1154
Comment pep:novel chromosome:BROADO5:6:150406352:150482271:1 gene:ENSMODG00000016682 transcript:ENSMODT00000036053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSASSLAAETESDHGFTGPSYPGHPATGWYRSSHSGPVWESALITRQHQHLHPRARSH
THSPGSMAAVREWSCTRCTFLNPAGQRQCSICEAPRQKPDLNHILRLSVEEQKWPCARCT
FRNFLGKEACEVCGFTPDPLPGTSPLPIINGVLPKPPTILVEPKGSCKEEAVLKVEAGES
GAKSPKEAEPESGWACQRCTLHNTPVANSCSACGGPRKLSLPKIPPEALVVPEVITPAGF
HVAPSTPQPSLPPDLPDVDSTSANQDPPATEQELPKMPSFSPFSPTLQNNPVPRSRREVP
PQLQPPVPEASQPATTTPGPKGSPQGQGRAPAAARFQEILATKRLSVLEEEAEASSPLWR
CSSCSLANPCGASRCENCGAPQGSDVIDLTGDTVRFTPASPSSPDFTTWSCARCTLKNPT
VAQKCKVCGSSKLHGFQEHGGGATPGEPAARCPDCSADKPGDCCCGRAPSARKAARLFPS
PPAALSEWACPACTLLNELKAKNCAACHTPQGCVAQRKGARPLTRRESMHVEKRRQTDEG
EAKALWENIVSFCQENKVNFVDDSFPPGPASVGFPEGDSVQQRVKQWLRPHEINCSIFKE
QTVGWSVFRTPRPSDILQGLLGNCWFLSALAVLAERPELVERVMITRTLCPEGAYQVRLC
KDGTWTTVLVDDMLPCDECGYLLFSQAQRKQLWVALMEKALAKLHGSYFALQAGRAIEGL
ATLTGAPCESLMLQVSSTNPREEPIDTDLIWAKMLSSKEAGFLMGASCGGGNMKVDDAAY
ESMGLRPRHAYSILDVRDVQGFRLLRLRNPWGRFSWNGNWSDEWPHWPGHLRHELMPHGS
SEGVFWMEYNDFMRYFDSVDICKIHSDWHEVRVQGAFPNKASGPITVTSLTVLERATLEF
ALFQEGSRRSDTVDSHLLDLCIMVFRATFSSGNKLSLGRLLAHSKRAVKKFVNCDVMLEP
GEYAVVCCAFNHWSPTTTAQVSSPTGGVGRSAPEPPGHILAIYSSRQVMVEQIEAQPTTL
ADAIILLTENKGERHEGREGMTCYYLTHGWAGLIVVVENRHPKSYLHVQCDCTDSFNVVS
TRGSLKTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLNDWMSTKGTHNPH
LTAEVAGLHGPRPL
Download sequence
Identical sequences F6ZW91
ENSMODP00000034465 ENSMODP00000034465 XP_016279629.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]