SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034647 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034647
Domain Number 1 Region: 22-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-36
Family Pentraxin (pentaxin) 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034647   Gene: ENSMODG00000024569   Transcript: ENSMODT00000036235
Sequence length 219
Comment pep:novel chromosome:BROADO5:2:166902285:166903946:-1 gene:ENSMODG00000024569 transcript:ENSMODT00000036235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKWLLWTLLLITFSRTMALTDLHRKVFLFPASSADSYVTLSPLKNTELQNFTVCLWTYT
ELTRGYSVFSYATQASTNEILLFRDSVGQYSLTVGSEEVTFQVQEPSFTPINICATWASA
SGVAEIWVDGIPLVRKVLKQGYTLSANAMIILGQDQDSYGGGFDINQSFVGEIGNVYMWD
YVVPFHEGKTDCSQANVLNWKKMKYEKMGHVIMVPQLRD
Download sequence
Identical sequences F7BTP2
ENSMODP00000034647 13616.ENSMODP00000034647 ENSMODP00000034647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]