SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034739 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034739
Domain Number 1 Region: 93-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034739
Domain Number - Region: 63-86
Classification Level Classification E-value
Superfamily Kringle-like 0.0977
Family Fibronectin type II module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034739   Gene: ENSMODG00000024589   Transcript: ENSMODT00000036328
Sequence length 180
Comment pep:novel chromosome:BROADO5:5:248604306:248604848:-1 gene:ENSMODG00000024589 transcript:ENSMODT00000036328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKSYCNLTDKLPTFSDSPHMQLTRSFYLDPVVTFHLYPEVPAPSSYSEDLPVHPFPTD
QLIVENFGDPCSFPFQMPYPSYGRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHLP
EEYLEKRLSKVETLRAAIKYINYLQSLLYRDEVEGKNKPGKGQAIVATTSHQMDPIFKIV
Download sequence
Identical sequences F6PFW1
ENSMODP00000034739 13616.ENSMODP00000034739 ENSMODP00000034739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]