SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034770 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034770
Domain Number 1 Region: 2248-2316,2405-2504,2602-2627,2661-2715
Classification Level Classification E-value
Superfamily Sialidases 0.000000000114
Family Sialidases (neuraminidases) 0.044
Further Details:      
 
Domain Number 2 Region: 2467-2552,2660-2694,2745-2997
Classification Level Classification E-value
Superfamily Sialidases 0.0000108
Family Sialidases (neuraminidases) 0.022
Further Details:      
 
Domain Number 3 Region: 683-709,816-861
Classification Level Classification E-value
Superfamily Sialidases 0.0000182
Family Sialidases (neuraminidases) 0.019
Further Details:      
 
Domain Number 4 Region: 1570-1684,1764-1810,1847-1872,1915-1976,2133-2165
Classification Level Classification E-value
Superfamily Sialidases 0.0000216
Family Sialidases (neuraminidases) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034770
Domain Number - Region: 2371-2396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Domain Number - Region: 472-525,669-744,827-856
Classification Level Classification E-value
Superfamily Sialidases 0.000216
Family Sialidases (neuraminidases) 0.034
Further Details:      
 
Domain Number - Region: 1033-1065,1206-1271
Classification Level Classification E-value
Superfamily Sialidases 0.000379
Family Sialidases (neuraminidases) 0.085
Further Details:      
 
Domain Number - Region: 563-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 921-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00188
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 2019-2050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00618
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 3120-3147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0911
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034770   Gene: ENSMODG00000017259   Transcript: ENSMODT00000036357
Sequence length 3384
Comment pep:novel chromosome:BROADO5:8:154526446:154981271:-1 gene:ENSMODG00000017259 transcript:ENSMODT00000036357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDALA
QQLCEQGAPTEAPLHPHLAEIHSDSVILRDDFDSYHQLELNPNIWIECNNCEIGEQCGVI
MHGNAVTFCEPYGPRELTTAGLNTTTASVLQFSIGSGSCRFSYSDPSIVVSYTKNNTADW
IQLEKIRAPSNISTIIHILYLPEDAKGENVQFQWKQEYIHAGDMYEACWALDNILIINSA
HRQIILEDNLDPVDTGNWLFFPGATVKHSCQSDGNAIYFHGTEGTEFNFATTRDIDLSTE
DVQEQWSEEFEDQPTGWDILGAVIGNECGTLESGLSMIFLKEGERKICTPYMDTTDYGNL
RFYFTMGGVCDPGESHENDVILYAKTEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTP
ATKFCLRQKNHLGYNRNVWAIDFFHVLPVLPSTVSHMIQFSINLGCGTHQPGNSVSLEFS
TNHGRSWSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTKDTRIRWRQ
IGPILGNMWAIDNIYVGPSCLKFCSGRGQCTRNGCKCDPGFSGPACEMASQTFPMFISES
FGSSRLSSYHNFYSIRGSEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTL
RLGSKSVLSTCKAPNQPGEGVLLHYSYDNGITWKLLDHYSYLNYHEPRIISVELPADAQQ
FGIQFRWWQPYHSSQGEDVWAIDEIIMTSILFNSISLDFTNLVEVTQSLGFYLGNVQPYC
GHDWTLCFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLDYST
NHGLTWHLVQEECLPGMPSCQEFTSASVYHSSEFTQWRRITVLLPQKTWSSATRFRWSQS
YYTAQDEWALDNIYIGQQCPNMCNGHGWCERGLCKCDQGYLGTECHPEASLPSTIMSDFE
SQNGWESDWQEVIGGEVVKPEQGCGVISSGSSLYFSKAGKRQLVSWDMDTSWVDFVQFYI
QIGGESTTCNKPDSREEGVLLQYSNNGGIHWHLLAEMYFSDFSKPRFVYLELPAAAKTPC
TRFRWWQPVFSGEDYDQWAIDDIIILSEKQKQIIPVVNPTLPQNFYEKPAFDYPMNQMSV
WLMLANEGMVKNETFCSATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCTNQFS
SSAPVLLQYSHDAGLFWSLVKEGCYPASPGGKGCEGSSRELSEPTVYYTGDFEEWTRITI
VIPRSLASSKTRFRWIQESSSQKNAPPFGLDGVYISEPCPSYCSGHGDCVSGVCFCDLGY
TAAYGTCVSNVPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGILSDGKSLYFSGPGKREA
RTVPLDTTNIRLVQFYVQIGSKTPGVTCSKPRARNEGLVVQYSNDNGILWHLLRELDFMS
FLEPQIISIDLPREAKTSATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFKDKFDGS
IDLQANWYRIQGGQVDIDCLSMDTALTFSESIGKPRYAETWDFHVTASTFIQFELSMGCS
KPFSDSHGVQLQYSLNNGRDWHLVTEECVPPTIGCLHYTESSIYTSERFQNWKRVTVYLP
LSTISPRTRFRWIQSNYTSGADSWAIDNVVLASGCPWMCSGHGMCELGHCVCDRGFGGPF
CVPIISLPSVLKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRD
LDCSNSLYVQFSLRFIAKGTPERSHSILLQYSISGGIIWHLMDEFYFTQTTNVLFINVPL
PYTAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNNINNPVILLDTFDFGPKEDNWFFY
PGGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFEINIGCSTDS
SSADPVRLEFSRDFGATWHLLLPLCYSSSSHISSLCSTEHHPSSTYYAGTTQGWRREVIH
FGKLHLCGSVRFRWYQGFYPASSQPVTWAIDNVYIGPQCEEMCNGHGSCINGTKCICDPG
YSGPTCKISTKNSDFLKDDFEGQLESDRFLLVSGGKPSRKCGILSSGNNLFFNEDGLRML
MTRDLDLSQARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLMQEFLFSNSSNVG
RYIALEIPLKARSSSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFSTLDSR
KWLLHPGGTKMPVCGSIGDALVFIEKASTRYVVSTDIAVNEDSFLQIDFAASCSVTDSCY
AIELEYSVDLGLSWHPVLRDCLPTNVECNRYHLQRILISDTFNKWTRITLPLPAYTRSQA
TRFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCVQGNCVCDEQWNGLYCDEPEIA
LPTQLKDNFNRVPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAE
FIQFYFMYGCLITPNNRNQGVLLEYSINGGITWNLLMEIFYDQYSKPGFVNLLLPPDAKE
TATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVG
RIAFDIFMEDKTTVNEHWLFHDDCTVERFCDSPDGVMICGSHDGREVYAVTHDLTPTEGW
IMQFKISVGCQVSDRIVQNQVHVQYSTDFGVSWNYLVPQCLPADPKCSGSVSQPSVFFPT
KGWKRITYPLPDSLVGNPVRFRFYQMYSDMQWAIDNFYLGPGCLDNCRGHGDCLKEQCIC
DLGYSGSNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGST
VRQAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPTCRKEGVLLDYSIDGGITWTLLHEM
DYQKYISVRHDYILLPEHALTNTTRLRWWQPFVISNGMVVSGVERAQWALDNILIGGAEI
NPSQLVDTFDDEGISHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNILSSRELI
IQPGYMIQFKIVVGCEASSCGDLHSVMLEYTKDTRSDSWQLVQTQCLPSSSNSIGCSPFQ
FHEATIYNSVNSSSWKRITIQLPDHVSSSATQFRWIQKGEEAEKQSWGIDHVYIGEACPK
LCSGHGYCTTGAVCICDESFQGDDCSVFSHDLPSYIKDNFESERVTEVNWETIQGGVIGN
GCGQLSPYAHGDSLYFNGCQIRQAVTKPLDLTRASKIMFVLQIGSTSQTDSCNTNLSDPN
TVDKAVLLQYSVNNGITWQVIAQHQPKDFIQAQRVSYNVPLEARMKGVLLRWWQPRHNGT
GHDQWALDHVEVVLSCRTEMLMSRRVRTDGSPRLTRRGESSRDEKSYIASKPHQTFMTNH
SAACIERHFLTCVIFHYLLSLVLH
Download sequence
Identical sequences F6Q6B3
ENSMODP00000034770 ENSMODP00000034770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]