SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034906 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034906
Domain Number 1 Region: 171-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-44
Family SPRY domain 0.015
Further Details:      
 
Domain Number 2 Region: 101-111
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034906   Gene: ENSMODG00000010656   Transcript: ENSMODT00000036494
Sequence length 740
Comment pep:novel chromosome:BROADO5:3:327634776:327720211:1 gene:ENSMODG00000010656 transcript:ENSMODT00000036494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQQQQQHQQQQHQHQQHQQQPQQLPTAAAVAPAPGVVLSAPNPISAGSSPAGPAAAAS
PGGGAGSGGSGGGGVGVGAGAAALLLHPPPPPPPPTTAAPPPPPPPPPPPPAAAAASPAP
GISAAASPAGGAPPSASGSNAPAPFPHGDPALNEQEKELQRRLKRLYPAVDEQETPLPRS
WSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDG
YMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLI
NNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTK
IQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQ
RIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSP
KSQDSYPVSPRPFSSPSMSPSHGMNIHSLASSKGSTTHFSGFESCSNGVISNKAHQSYCH
SKHQSTSLNVPELNSINVSRSQQINSFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDH
EMEECDTEMEVDSSHLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLK
DAFSLLAYSDPWSSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLG
LMARSGIGSCAFATVEDYLH
Download sequence
Identical sequences F6QUG9
XP_007487987.1.35504 ENSMODP00000034906 ENSMODP00000034906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]