SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034911 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034911
Domain Number 1 Region: 197-274
Classification Level Classification E-value
Superfamily DEATH domain 0.0000033
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034911   Gene: ENSMODG00000007986   Transcript: ENSMODT00000036499
Sequence length 284
Comment pep:novel chromosome:BROADO5:2:153200563:153274831:-1 gene:ENSMODG00000007986 transcript:ENSMODT00000036499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKQEVSTRKEPAKTQGGGGGRGGGVGVFLSARPGKAEVSILPLPGIPSFLLSSPLPHAF
PFPTRLSSPKLELVLLHPASMASAEDPLLTDHATREPVEDTDPSTLSFKMSEKYPVQDTG
LPKGKSRSAQGKPCPLYLREFFQREENGYPDSTGDPLSDIKDNSCQENCTCSLCSLRAPN
ISDLLNDEDLLDVIRIKLDPCHPTVKNWRNFASKWGMHYDELCFLEQKQQSPTLEFLLRN
SHKTVDQLIELCRLYHRVDVEKVLRRWVEEEWPKRGHGDYHNHF
Download sequence
Identical sequences F6QAU1
ENSMODP00000034911 ENSMODP00000034911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]