SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034966 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034966
Domain Number 1 Region: 150-327
Classification Level Classification E-value
Superfamily MIR domain 9.59e-51
Family MIR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1014-1103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-18
Family SPRY domain 0.028
Further Details:      
 
Domain Number 3 Region: 3938-4016
Classification Level Classification E-value
Superfamily EF-hand 0.00000000109
Family Calmodulin-like 0.043
Further Details:      
 
Domain Number 4 Region: 592-740
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000514
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 34-115
Classification Level Classification E-value
Superfamily MIR domain 0.00000366
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 355-481
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000102
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2080-2145
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034966
Domain Number - Region: 1345-1466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000269
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034966   Gene: ENSMODG00000007421   Transcript: ENSMODT00000036554
Sequence length 4896
Comment pep:novel chromosome:BROADO5:2:151715905:152253709:-1 gene:ENSMODG00000007421 transcript:ENSMODT00000036554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLANTMEKAEGQVDIEKWKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSST
DKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGSDI
LHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTV
HYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLLDDKSLLLMDKE
KADVKSTAFSFRSSKEKLDIGIRKEIDGMGTSEIKYGDSVCYIQHVDTGLWLTYQSVDVK
SVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKV
KSSTIDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLE
CIDRLHVYSSAAHFADVAGKEAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLIS
RLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC
HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGISEGSAQYRKWYYELMVD
HTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIART
VSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKV
RFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKLKVEHSREYKQDRTYSRDLLGPTVSLSQA
AFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVE
FSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLSSGYKPAP
MDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYALLDD
RTKKSNKDSLREAVRTLLGYGYNLEAPDQDHATRTEVCSGTGEKFRIFRAEKTYAVKTGR
WYFEFEAVTAGDMRVGWSRLGCQPDQELGSDEQAFAFDGFKAQRWHQGSEHYGRSWQAGD
VVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFEVVDGFIPVCSLGVAQVGRMNFGKD
VSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSS
PCLKVTQKSFSSQNSSTDIMFYRLSMPIECAEVFSKTAAGGLPGTSLFGPKNDLEDYDAD
SDFEVLMKTAHGHLVPDRVEKEKEATKPEFNNHKDYAQEKPSRLKQRFMLRRTKPDYSTS
HSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTVFDLD
RVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGLLTF
TANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPIP
QCPPRLHVQFLTHVLWSRMPNQFLKVDVSRISERQGWLVQCVDPLQFMSLHIPEENRSVD
ILELTEQEELLKFHYHTLRLYSAVCALGNNRVAHALCSHVDEPQLLYAIENKYMPGLLRT
GYYDLLIDIHLSSYATARLMMNNEFIVPMTDETKSITLFPDENKKHGLPGIGLSTSLRPR
MQFSSPSFVSISNEYYQFSPEFPLDILKSKTIQMLTEAVKEGSLHARDPVGGTTEFLFVP
LIKLFYTLLIMGIFNNEDLKHILQLIEPSVFKEAANKEEENEVLEKELNTEDQGLEGGRE
EEIRGEKMPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQ
RFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEDIRDQLLDFH
EDLMTHCGIELDEDGALDGNSDLTIRGRLLYLVEKVTYLKKKQTEKPIENDSKKPSTLQQ
LISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTISLL
ASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLG
GGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPL
DVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVTKGYPDIGWNPVEGERYLD
FLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPTRD
GPSPTNGSSKTLDLAAEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIR
SILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEV
QDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEH
HASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLN
EHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQE
LFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYF
INKYAEHTHDKWSMEKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLK
TMLAWGWRIERTREGDSMALYTRTRRISQTSQVSIDTAHGYSPRAIDMSNVTLSRDLHAM
AEMMAENYHNIWAKKKKLELEAKVGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQIN
GYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQE
IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLSTGGHASNKEKEMVTSLFCKLGVLVRHRI
SLFGNDASSIVNCLHILGQTLDARTVMKTGMESVKIALRAFLDNAAEDLEKTMENLKQGQ
FTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYA
LGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLNKHNTYSIYNTKSTRERTALNLPT
SVEEVCPNIPSLEKLMDEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPE
KADTCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKSQLLKSHF
LPLMEKLKNKAAVVVSDEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDF
NRAKWLKEPNSEAEELFRMVAEVFIFWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKM
SKAAVTDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSMK
DTEDEVRDIIRSNLHLQGKLEDPAIRWQMALYKDLPNRTEETSDPEKTIERVLDIANVLF
HLEQKPTNMGRRYYSMVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNL
FLQGYEKSWIETEEHYFEDKLIEDLAKPGLELPEEDEGTKKVDPLHQLILLFSRTALTEK
CKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARL
HDRGAAEMVLQTISASKGDTGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQ
SLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHN
SDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQ
VAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKEL
MDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDT
FKEYDPDGKGIISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPA
KDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFE
ISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDL
NERSVNKEETEKEKPEEQEPRMGFFSIMTVKSALLALRYNILTIMRMLSLKSLKKQMKRI
KKMTMKDLVMALFSSYWSILVGLLHFISSVFRGFFRIMCSLLLGGSLVEGAKKIKVAELL
ANMPDPTQDEVRGDGEEGERKALETALPTEDLTDLKELTEESDLLSDIFGLDLKREGGQY
KLIPHNPNAGLSDLMSNPIPVPEVQEKCQEQKVKEDEKEEKEETKSEPEKAEGEDGEKEE
KAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAF
AINFILLFYKVSTSSVVEGKEIPSPSASENSRISSLDSTAHRLITVHYVLEESSGYMEPT
LRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWD
RLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKD
SSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFK
TLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLT
CYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFG
ELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDET
EHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences F6XBV3
ENSMODP00000034966 ENSMODP00000034966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]